PDB entry 5hqw

View 5hqw on RCSB PDB site
Description: crystal structure of a trans-at pks dehydratase domain of c0zgq6 from brevibacillus brevis
Deposited on 2016-01-22, released 2017-01-25
The last revision was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative polyketide synthase
    Species: Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) [TaxId:358681]
    Gene: BBR47_39880
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: putative polyketide synthase
    Species: Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) [TaxId:358681]
    Gene: BBR47_39880
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hqwA (A:)
    smigltagepaylhpllhqntstlseqrysstftgqefflrdhvvngqkvlpgvaylema
    rvavdmaagvrtdnhsaiqlknivwakpvivedapiqvhkglypeengeitfeiyshpre
    aeeslvvhsqgravlrsameapaldlsaiqaqctessysfsqcyetfhriglaygpshqg
    ieklfvgpdqvlaklvlpssvtgtaekfvlhpsvmdaalqaslgfmmgtsdlqpslpfal
    eelniysastaaawalvrysdgnattqkvqkldidlcdeqgticvsmkgfttrvlegeka
    agvaknkgtgeagkitstlmlqpvwiekgipkeaka
    

    Sequence, based on observed residues (ATOM records):
    >5hqwA (A:)
    paylhpllhqntstlseqrysstftgqefflrdhvvngqkvlpgvaylemarvavdmaag
    vrtdnhsaiqlknivwakpvivedapiqvhkglypeengeitfeiyshpreaeeslvvhs
    qgravlrsameapaldlsaiqaqctessysfsqcyetfhriglaygpshqgieklfvgpd
    qvlaklvlpssvtgtaekfvlhpsvmdaalqaslgfmmgtsdlqpslpfaleelniysas
    taaawalvrysdgnattqkvqkldidlcdeqgticvsmkgfttrvle
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hqwB (B:)
    smigltagepaylhpllhqntstlseqrysstftgqefflrdhvvngqkvlpgvaylema
    rvavdmaagvrtdnhsaiqlknivwakpvivedapiqvhkglypeengeitfeiyshpre
    aeeslvvhsqgravlrsameapaldlsaiqaqctessysfsqcyetfhriglaygpshqg
    ieklfvgpdqvlaklvlpssvtgtaekfvlhpsvmdaalqaslgfmmgtsdlqpslpfal
    eelniysastaaawalvrysdgnattqkvqkldidlcdeqgticvsmkgfttrvlegeka
    agvaknkgtgeagkitstlmlqpvwiekgipkeaka
    

    Sequence, based on observed residues (ATOM records):
    >5hqwB (B:)
    paylhpllhqntstlseqrysstftgqefflrdhvvngqkvlpgvaylemarvavdmaag
    vrtdnhsaiqlknivwakpvivedapiqvhkglypeengeitfeiyshpreaeeslvvhs
    qgravlrsameapaldlsaiqaqctessysfsqcyetfhriglaygpshqgieklfvgpd
    qvlaklvlpssvtgtaekfvlhpsvmdaalqaslslpfaleelniysastaaawalvrys
    dgnattqkvqkldidlcdeqgticvsmkgft