PDB entry 5hqt

View 5hqt on RCSB PDB site
Description: Crystal structure of an aspartate/glutamate racemase from Escherichia coli O157
Class: isomerase
Keywords: Aspartate/glutamate racemase, PLP-independent racemase, Racemization mechanism, ISOMERASE
Deposited on 2016-01-22, released 2016-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-18, with a file datestamp of 2016-05-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate/glutamate racemase
    Species: Escherichia coli O157:H7 str. SS52 [TaxId:1330457]
    Gene: ygeA, SS52_3985
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6FBL7 (0-229)
      • expression tag (230-234)
    Domains in SCOPe 2.07: d5hqta1, d5hqta2, d5hqta3
  • Heterogens: NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hqtA (A:)
    mktigllggmswestipyyrlinegikqrlgglhsaqvllhsvdfheieecqrrgewdkt
    gdilaeaalglqragaegivlctntmhkvadaiesrctlpflhiadatgraitgagmtrv
    allgtrytmeqdfyrgrlteqfsinclipeaderakinqiifeelclgqfteasrayyaq
    viarlaeqgaqgvifgcteigllvpeersvlpvfdtaaihaedavafmlslehhh