PDB entry 5hqm

View 5hqm on RCSB PDB site
Description: Structure function studies of R. palustris RubisCO (R. palustris/R. rubrum chimera)
Class: lyase
Keywords: RubisCO, hexamer, LYASE
Deposited on 2016-01-21, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose bisphosphate carboxylase (R. palustris/R. rubrum chimera),Ribulose bisphosphate carboxylase
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: cbbM, cbbL2, rbpL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hqma1, d5hqma2
  • Chain 'B':
    Compound: Ribulose bisphosphate carboxylase (R. palustris/R. rubrum chimera),Ribulose bisphosphate carboxylase
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: cbbM, cbbL2, rbpL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hqmb1, d5hqmb2
  • Heterogens: CAP, MG, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hqmA (A:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklgved
    trsalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hqmA (A:)
    qsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevsttd
    dftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdveya
    kmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacy
    dfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyeml
    argefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskr
    gytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmn
    pttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqga
    dpvefakdhrefarafesfpqdadklypnwraklgvedt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hqmB (B:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklgved
    trsalpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hqmB (B:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwra