PDB entry 5hqj

View 5hqj on RCSB PDB site
Description: Crystal structure of ABC transporter Solute Binding Protein B1G1H7 from Burkholderia graminis C4D1M, target EFI-511179, in complex with D-arabinose
Class: solute-binding protein
Keywords: ABC TRANSPORTER SOLUTE BINDING PROTEIN, ENZYME FUNCTION INITIATIVE, EFI, Structural Genomics, SOLUTE-BINDING PROTEIN
Deposited on 2016-01-21, released 2016-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic binding protein/LacI transcriptional regulator
    Species: Burkholderia graminis C4D1M [TaxId:396598]
    Gene: BgramDRAFT_3172
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1G1H7 (23-310)
      • expression tag (22)
    Domains in SCOPe 2.08: d5hqja1, d5hqja2
  • Heterogens: 64K, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hqjA (A:)
    mhhhhhhssgvdlgtenlyfqsmkdakdisvavipkvavpffddcnkgaktaadkagvky
    qwvvpqntqgstqvqiiedlisrhvdgiaisvnepksvesvmkraeqsgikvltydsdsp
    ksgrsmyigtnneqagatmaetmgkalngqgevaiitgqlgavnlneriagikkglakyp
    gikvvetqgtdddlargvsvvettlrahpnlkgifgvsqvggpavakvlntrefgamkgk
    levlafddlpdtlkglkdgyiqgimvqrpvtmgslavdhlvaqiqgqegqpkdidtgvtv
    vtkdnmtsytk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hqjA (A:)
    mkdakdisvavipkvavpffddcnkgaktaadkagvkyqwvvpqntqgstqvqiiedlis
    rhvdgiaisvnepksvesvmkraeqsgikvltydsdspksgrsmyigtnneqagatmaet
    mgkalngqgevaiitgqlgavnlneriagikkglakypgikvvetqgtdddlargvsvve
    ttlrahpnlkgifgvsqvggpavakvlntrefgamkgklevlafddlpdtlkglkdgyiq
    gimvqrpvtmgslavdhlvaqiqgqegqpkdidtgvtvvtkdnmtsytk