PDB entry 5hqa

View 5hqa on RCSB PDB site
Description: a glycoside hydrolase family 97 enzyme in complex with acarbose from pseudoalteromonas sp. strain k8
Deposited on 2016-01-21, released 2017-01-11
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-glucosidase
    Species: Pseudoalteromonas sp. K8 [TaxId:1719649]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, CL, MG, GOL, FMT, UNX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hqaA (A:)
    atvqspdgnikiiisdeqstpsysisfknktvinnsalgfefkqhapfsnsfkitkvqqq
    stntqwqqpwgerqtvvdqhnevtvtfakpqpqggtysvrfkafdsgvgfryevpkqagl
    nnieitkeltefavnnshtatawwipargwnryeyvynttplndaalvhtpftfknqdgv
    hisiheaalvdyaamvlnqrrpgvfqadltpwssgvavkkqgafntpwrtiqigekavdl
    vnsdiilnlnepnklgdvswvkpgkyigiwwgmhinthtwgsgdkhgattkntkyymdfa
    akygfdgvlvegwntgwdgdwffngdvfsftqpyddfdiaaltkyskqtgvqlighhets
    gnvsnyrkqmadafalyeksnvsqvktgyvadggnikridkngiarhewhdgqfmvneyl
    hnvklaakhkisinthepikdtglrrtypnwitregargqefnawgtppnppehismlaf
    trmlagpmdftpgifdlsfnglgantnrpqttlakqlalyvvlyspiqmaadlpknylak
    pdafqfiqdvptdwqqsialdgavgdfivfarkerkrdkytgndwylgavtdeqartiei
    sldfldngkqfeahiykdgknaewknnpydltiekrlvtasdkltlklatsggtairfka
    llehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5hqaA (A:)
    atvqspdgnikiiisdeqstpsysisfknktvinnsalgfefkqhapfsnsfkitkvqqq
    stntqwqqpwgerqtvvdqhnevtvtfakpqpqggtysvrfkafdsgvgfryevpkqagl
    nnieitkeltefavnnshtatawwipargwnryeyvynttplndaalvhtpftfknqdgv
    hisiheaalvdyaamvlnqrrpgvfqadltpwssgvavkkqgafntpwrtiqigekavdl
    vnsdiilnlnepnklgdvswvkpgkyigiwwgmhinthtwgsgdkhgattkntkyymdfa
    akygfdgvlvegwntgwdgdwffngdvfsftqpyddfdiaaltkyskqtgvqlighhets
    gnvsnyrkqmadafalyeksnvsqvktgyvadggnikridkngiarhewhdgqfmvneyl
    hnvklaakhkisinthepikdtglrrtypnwitregargqefnawgtppnppehismlaf
    trmlagpmdftpgifdlsfnglgantnrpqttlakqlalyvvlyspiqmaadlpknylak
    pdafqfiqdvptdwqqsialdgavgdfivfarkerkrdkytgndwylgavtdeqartiei
    sldfldngkqfeahiykdgknaewknnpydltiekrlvtasdkltlklatsggtairfka
    ll