PDB entry 5hpr

View 5hpr on RCSB PDB site
Description: insulin with proline analog hyp at position b28 in the t2 state
Deposited on 2016-01-21, released 2017-01-25
The last revision was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin a-chain
    Species: Homo sapiens [TaxId:9606]
    Gene: INS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: insulin b-chain
    Species: Homo sapiens [TaxId:9606]
    Gene: INS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5hprA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5hprB (B:)
    fvnqhlcgshlvealylvcgergffytpkt