PDB entry 5hpq

View 5hpq on RCSB PDB site
Description: Crystal structure of cyclohexadienyl dehydratase from Pseudomonas aeruginosa bound to acetate
Class: lyase
Keywords: Lyase, phenylalanine biosynthesis, cyclohexadienyl dehydratase, periplasmic binding protein
Deposited on 2016-01-20, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclohexadienyl dehydratase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: pheC, PA3475
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hpqa_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hpqA (A:)
    mrgshhhhhhiqesrldrilesgvlrvattgdykpfsyrteeggyagfdvdmaqrlaesl
    gaklvvvptswpnlmrdfaddrfdiamsgisinlerqrqayfsipylrdgktpitlcsee
    arfqtleqidqpgvtaivnpggtnekfaranlkkarilvhpdnvtifqqivdgkadlmmt
    daiearlqsrlhpelcavhpqqpfdfaekayllprdeafkryvdqwlhiaeqsgllrqrm
    ehwleyrwptahgkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hpqA (A:)
    esrldrilesgvlrvattgdykpfsyrteeggyagfdvdmaqrlaeslgaklvvvptswp
    nlmrdfaddrfdiamsgisinlerqrqayfsipylrdgktpitlcseearfqtleqidqp
    gvtaivnpggtnekfaranlkkarilvhpdnvtifqqivdgkadlmmtdaiearlqsrlh
    pelcavhpqqpfdfaekayllprdeafkryvdqwlhiaeqsgllrqrmehwleyrwpt