PDB entry 5hpn

View 5hpn on RCSB PDB site
Description: a circularly permuted pdua forming an icosahedral cage
Deposited on 2016-01-20, released 2016-04-06
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Permuted PduA
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HPN
  • Chain 'B':
    Compound: Permuted PduA
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HPN
  • Chain 'C':
    Compound: Permuted PduA
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HPN
  • Chain 'D':
    Compound: Permuted PduA
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HPN
  • Chain 'E':
    Compound: Permuted PduA
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HPN
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hpnA (A:)
    gkavhviprphtdvekilggsggsealgmvetkgltaaieaadamvasanvmlvgyekig
    sglvtvivrgdvgavkaatdagaaaarnvg
    

    Sequence, based on observed residues (ATOM records):
    >5hpnA (A:)
    avhviprphtdvekilggsggsealgmvetkgltaaieaadamvasanvmlvgyekigsg
    lvtvivrgdvgavkaatdagaaaarnv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hpnB (B:)
    gkavhviprphtdvekilggsggsealgmvetkgltaaieaadamvasanvmlvgyekig
    sglvtvivrgdvgavkaatdagaaaarnvg
    

    Sequence, based on observed residues (ATOM records):
    >5hpnB (B:)
    avhviprphtdvekilggsealgmvetkgltaaieaadamvasanvmlvgyekigsglvt
    vivrgdvgavkaatdagaaaarnv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hpnC (C:)
    gkavhviprphtdvekilggsggsealgmvetkgltaaieaadamvasanvmlvgyekig
    sglvtvivrgdvgavkaatdagaaaarnvg
    

    Sequence, based on observed residues (ATOM records):
    >5hpnC (C:)
    avhviprphtdvekilgggsealgmvetkgltaaieaadamvasanvmlvgyekigsglv
    tvivrgdvgavkaatdagaaaarnv
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hpnD (D:)
    gkavhviprphtdvekilggsggsealgmvetkgltaaieaadamvasanvmlvgyekig
    sglvtvivrgdvgavkaatdagaaaarnvg
    

    Sequence, based on observed residues (ATOM records):
    >5hpnD (D:)
    avhviprphtdvekisealgmvetkgltaaieaadamvasanvmlvgyekigsglvtviv
    rgdvgavkaatdagaaaarnv
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5hpnE (E:)
    gkavhviprphtdvekilggsggsealgmvetkgltaaieaadamvasanvmlvgyekig
    sglvtvivrgdvgavkaatdagaaaarnvg
    

    Sequence, based on observed residues (ATOM records):
    >5hpnE (E:)
    avhviprphtdvekilggsggsealgmvetkgltaaieaadamvasanvmlvgyekigsg
    lvtvivrgdvgavkaatdagaaaarnv