PDB entry 5hpl

View 5hpl on RCSB PDB site
Description: System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes: Rsp5 and UbV R5.4
Class: ligase
Keywords: HECT E3, Rsp5, Ubiquitin, Ubv, LIGASE
Deposited on 2016-01-20, released 2016-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rsp5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hpla_
  • Chain 'B':
    Compound: Rsp5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hplb_
  • Chain 'C':
    Compound: Ubiquitin variant R5.4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HPL
  • Chain 'D':
    Compound: Ubiquitin variant R5.4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HPL
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hplA (A:)
    qykrdfrrkviyfrsqpalrilpgqchikvrrknifedayqeimrqtpedlkkrlmikfd
    geegldyggvsrefffllshemfnpfyclfeysaydnytiqinpnsginpehlnyfkfig
    rvvglgvfhrrfldaffvgalykmmlrkkvvlqdmegvdaevynslnwmlensidgvldl
    tfsadderfgevvtvdlkpdgrnievtdgnkkeyvelytqwrivdrvqeqfkafmdgfne
    lipedlvtvfderelelliggiaeidiedwkkhtdyrgyqesdeviqwfwkcvsewdneq
    rarllqfttgtsripvngfkdlqgsdgprrftiekagevqqlpkshtcfnrvdlpqyvdy
    dsmkqkltlaveetigfgqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hplA (A:)
    dfrrkviyfrsqpalrilpgqchikvrrknifedayqeimrqtpedlkkrlmikfdgeeg
    ldyggvsrefffllshemfnpfyclfeysaydnytiqinpnsginpehlnyfkfigrvvg
    lgvfhrrfldaffvgalykmmlrkkvvlqdmegvdaevynslnwmlensidgvldltfsa
    dderfgevvtvdlkpdgrnievtdgnkkeyvelytqwrivdrvqeqfkafmdgfnelipe
    dlvtvfderelelliggiaeidiedwkkhtdyrgyqesdeviqwfwkcvsewdneqrarl
    lqfttgtsripvngfkdlqgsdgprrftiekagevqqlpkshtcfnrvdlpqyvdydsmk
    qkltlaveet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hplB (B:)
    qykrdfrrkviyfrsqpalrilpgqchikvrrknifedayqeimrqtpedlkkrlmikfd
    geegldyggvsrefffllshemfnpfyclfeysaydnytiqinpnsginpehlnyfkfig
    rvvglgvfhrrfldaffvgalykmmlrkkvvlqdmegvdaevynslnwmlensidgvldl
    tfsadderfgevvtvdlkpdgrnievtdgnkkeyvelytqwrivdrvqeqfkafmdgfne
    lipedlvtvfderelelliggiaeidiedwkkhtdyrgyqesdeviqwfwkcvsewdneq
    rarllqfttgtsripvngfkdlqgsdgprrftiekagevqqlpkshtcfnrvdlpqyvdy
    dsmkqkltlaveetigfgqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hplB (B:)
    rdfrrkviyfrsqpalrilpgqchikvrrknifedayqeimrqtpedlkkrlmikfdgee
    gldyggvsrefffllshemfnpfyclfeysaydnytiqinpnsginpehlnyfkfigrvv
    glgvfhrrfldaffvgalykmmlrkkvvlqdmegvdaevynslnwmlensidgvldltfs
    adderfgevvtvdlkpdgrnievtdgnkkeyvelytqwrivdrvqeqfkafmdgfnelip
    edlvtvfderelelliggiaeidiedwkkhtdyrgyqesdeviqwfwkcvsewdneqrar
    llqfttgtsripvngfkdlqgsdgprrftiekagevqqlpkshtcfnrvdlpqyvdydsm
    kqkltlavee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hplC (C:)
    mghhhhhhmqifvktptrksislevepsdtienvkakiqdkegippdqqrlifagkqled
    grtlsdyniqkestlhlvlrlpgtik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hplC (C:)
    hhhhmqifvktptrksislevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlpgti
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hplD (D:)
    mghhhhhhmqifvktptrksislevepsdtienvkakiqdkegippdqqrlifagkqled
    grtlsdyniqkestlhlvlrlpgtik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hplD (D:)
    hhhhmqifvktptrksislevepsdtienvkakiqdkegippdqqrlifagkqledgrtl
    sdyniqkestlhlvlrlpgti