PDB entry 5hpj

View 5hpj on RCSB PDB site
Description: Photobacterium profundum alpha-carbonic anhydrase
Class: lyase
Keywords: carbonic anhydrase, psychrophile, alpha class, LYASE
Deposited on 2016-01-20, released 2016-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase
    Species: Photobacterium profundum SS9 [TaxId:298386]
    Gene: EBIG1812, PBPRA3376
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hpja_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hpjA (A:)
    ewsytgehgtehwgdsfatcaegvnqtpidinqttqaelaplhldyegqvtelvnnghti
    qanltgkntltvdgktfelkqfhfhtpsenylkgkqypleahfvhatdkgelavvavmfd
    fgprsnnelttllasipskgqtvelkealnpadllprdreyyrfngslttppcsegvrwf
    vmqepqtsskaqteklqavmgnnarplqplnarlile