PDB entry 5hpg

View 5hpg on RCSB PDB site
Description: structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen
Class: serine protease
Keywords: serine protease, kringle 5, human plasminogen, fibrinolysis
Deposited on 1997-09-19, released 1998-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.166
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00747 (0-83)
      • conflict (14)
    Domains in SCOPe 2.08: d5hpga_
  • Chain 'B':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00747 (0-83)
      • conflict (14)
    Domains in SCOPe 2.08: d5hpgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hpgA (A:)
    dcmfgngkgyrgkrvttvtgtpcqdwaaqephrhsiftpetnpragleknycrnpdgdvg
    gpwcyttnprklydycdvpqcaap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hpgB (B:)
    dcmfgngkgyrgkrvttvtgtpcqdwaaqephrhsiftpetnpragleknycrnpdgdvg
    gpwcyttnprklydycdvpqcaap