PDB entry 5hpc

View 5hpc on RCSB PDB site
Description: Structure of XacCel5A crystallized in the space group P41212
Class: hydrolase
Keywords: endo-beta-1, 4-glucanase, HYDROLASE
Deposited on 2016-01-20, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: egl, XAC0030
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PRD3 (21-End)
      • expression tag (20)
      • conflict (138)
    Domains in SCOPe 2.07: d5hpca1, d5hpca2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hpcA (A:)
    mgsshhhhhhssglvprgshmlkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfag
    kgmntirlpflwervqpelngpldqaqlglikksleaakankqylildlhnyatysgkri
    gtsdvpagaladlwrrlapefkddkavifglmnepngisapdwanaaqgtitairktgak
    nlilvpgtaytgahswrstsygvsnakaleilkdpgnnlafeahqyldkdysgtkpvcts
    dsvgqeklqgftswlrenkqkgflgefatannpvcdkalegmltymeknsdvwlgwtwwa
    agawwkpdypftvqpgkdgsdkpqmailskyarragk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hpcA (A:)
    mlkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpeln
    gpldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlape
    fkddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgahswrsts
    ygvsnakaleilkdpgnnlafeahqyldkdysgtkpvctsdsvgqeklqgftswlrenkq
    kgflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdgs
    dkpqmailskyarrag