PDB entry 5hpa

View 5hpa on RCSB PDB site
Description: the crystal of rhodanese domain of ygap treated with sodium thiosulfate
Deposited on 2016-01-20, released 2017-02-01
The last revision was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inner membrane protein YgaP
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ygaP, b2668, JW2643
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hpaA (A:)
    mksshhhhhhenlyfqsnaalttisphdaqeliargaklidirdadeylrehipeadlap
    lsvleqsglpaklrheqiifhcqagkrtsnnadklaaiaapaeiflledgidgwkkaglp
    vavnksq
    

    Sequence, based on observed residues (ATOM records):
    >5hpaA (A:)
    ttisphdaqeliargaklidirdadeylrehipeadlaplsvleqsglpaklrheqiifh
    cqagkrtsnnadklaaiaapaeiflledgidgwkkaglpvavn