PDB entry 5hp7

View 5hp7 on RCSB PDB site
Description: Crystal structures of RidA in the apo form
Class: hydrolase
Keywords: RidA, enamine/imine, deamination, HYDROLASE
Deposited on 2016-01-20, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Reactive Intermediate Deaminase A, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RIDA, At3g20390, MQC12.15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hp7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hp7A (A:)
    gphmstekapaalgpysqaikannlvflsgvlglipetgkfvsesvedqteqvlknmgei
    lkasgadyssvvkttimladladfktvneiyakyfpapsparstyqvaalplnakieiec
    iatl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hp7A (A:)
    sqaikannlvflsgvlglipetgkfvsesvedqteqvlknmgeilkasgadyssvvktti
    mladladfktvneiyakyfpapsparstyqvaalplnakieieciatl