PDB entry 5hp2

View 5hp2 on RCSB PDB site
Description: human adenosine deaminase acting on dsrna (adar2) bound to dsrna sequence derived from s. cerevisiae bdf2 gene with au basepair at reaction site
Deposited on 2016-01-20, released 2016-04-13
The last revision was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double-stranded RNA-specific editase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ADARB1, ADAR2, DRADA2, RED1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: RNA (5'-r(*up*up*cp*cp*cp*cp*ap*cp*ap*up*up*(8az)p*gp*ap*cp*gp*up*up*cp*ap*gp*up*c)-3')
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
  • Chain 'C':
    Compound: RNA (5'-r(*gp*ap*cp*up*gp*ap*ap*cp*gp*ap*cp*up*ap*ap*up*gp*up*gp*gp*gp*gp*ap*a)-3')
    Species: SACCHAROMYCES CEREVISIAE, synthetic [TaxId:4932]
  • Chain 'D':
    Compound: Double-stranded RNA-specific editase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ADARB1, ADAR2, DRADA2, RED1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IHP, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hp2A (A:)
    lhldqtpsrqpipseglqlhlpqvladavsrlvlgkfgdltdnfsspharrkvlagvvmt
    tgtdvkdakvisvstgtkcingeymsdrglalndchaeiisrrsllrflytqlelylnnk
    ddqkrsifqkserggfrlkenvqfhlyistspcgdarifsphepileepadrhpnrkarg
    qlrtkiesgegtipvrsnasiqtwdgvlqgerlltmscsdkiarwnvvgiqgsllsifve
    piyfssiilgslyhgdhlsramyqrisniedlpplytlnkpllsgisnaearqpgkapnf
    svnwtvgdsaievinattgkdelgrasrlckhalycrwmrvhgkvpshllrskitkpnvy
    hesklaakeyqaakarlftafikaglgawvekpteqdqfsltp
    

    Sequence, based on observed residues (ATOM records):
    >5hp2A (A:)
    psrqpipseglqlhlpqvladavsrlvlgkfgdltdnfsspharrkvlagvvmttgtdvk
    dakvisvstgtkcingeymsdrglalndchaeiisrrsllrflytqlelylnnkddqkrs
    ifqkserggfrlkenvqfhlyistspcgdarifsphepileepadrhpnrkargqlrtki
    esgegtipvrsnasiqtwdgvlqgerlltmscsdkiarwnvvgiqgsllsifvepiyfss
    iilgslyhgdhlsramyqrisniedlpplytlnkpllsgisnaearqpgkapnfsvnwtv
    gdsaievinattgkdelgrasrlckhalycrwmrvhgkvpshllrskitkpnvyheskla
    akeyqaakarlftafikaglgawvekpteqdqfslt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hp2D (D:)
    lhldqtpsrqpipseglqlhlpqvladavsrlvlgkfgdltdnfsspharrkvlagvvmt
    tgtdvkdakvisvstgtkcingeymsdrglalndchaeiisrrsllrflytqlelylnnk
    ddqkrsifqkserggfrlkenvqfhlyistspcgdarifsphepileepadrhpnrkarg
    qlrtkiesgegtipvrsnasiqtwdgvlqgerlltmscsdkiarwnvvgiqgsllsifve
    piyfssiilgslyhgdhlsramyqrisniedlpplytlnkpllsgisnaearqpgkapnf
    svnwtvgdsaievinattgkdelgrasrlckhalycrwmrvhgkvpshllrskitkpnvy
    hesklaakeyqaakarlftafikaglgawvekpteqdqfsltp
    

    Sequence, based on observed residues (ATOM records):
    >5hp2D (D:)
    tpsrqpipseglqlhlpqvladavsrlvlgkfgdltdnfsspharrkvlagvvmttgtdv
    kdakvisvstgtkcingeymsdrglalndchaeiisrrsllrflytqlelylnnkddqkr
    sifqkserggfrlkenvqfhlyistspcgdarifsphepileepadrhpnrkargqlrtk
    iesgegtipvrsnasiqtwdgvlqgerlltmscsdkiarwnvvgiqgsllsifvepiyfs
    siilgslyhgdhlsramyqrisniedlpplytlnkpllsgisnaearqpgkapnfsvnwt
    vgdsaievinattgkdelgrasrlckhalycrwmrvhgkvpshllrskitkpnvyheskl
    aakeyqaakarlftafikaglgawvekpteqdqfslt