PDB entry 5hoz

View 5hoz on RCSB PDB site
Description: Crystal structure of Equine Serum Albumin (ESA) at pH 9.0
Class: transport protein
Keywords: albumin, ESA, pH, Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, TRANSPORT PROTEIN
Deposited on 2016-01-19, released 2016-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35747 (Start-582)
      • engineered mutation (559)
    Domains in SCOPe 2.06: d5hoza1, d5hoza2, d5hoza3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hozA (A:)
    dthkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesae
    ncdkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepd
    aqcaafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipk
    ldalkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkv
    hkecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsd
    lpalaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekcc
    aeadppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstp
    tlveigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdsl
    aerrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatk
    eqlktvlgnfsafvakccgaedkeacfaeegpklvassqlala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hozA (A:)
    hkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaancdkslh
    tlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaqcaafq
    edpdkflgkylyevarrhpyfygpellfhaeeykadfteccplaclipkldalkerills
    sakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhkecchgdlle
    caddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlpalaadfaed
    keickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccaeadppacyrt
    vfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstptlveigrtlgk
    vgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdslaerrpcfsale
    ldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatkeqlktvlgnfs
    afvakccgaedkeacfaeegpklvassqlala