PDB entry 5hot

View 5hot on RCSB PDB site
Description: structural basis for inhibitor-induced aggregation of hiv-1 integrase
Deposited on 2016-01-19, released 2016-12-14
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 4.4 Å
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72498
      • engineered mutation (184)
  • Chain 'B':
    Compound: integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72498
      • engineered mutation (184)
  • Heterogens: 2SQ

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hotA (A:)
    hldgidkaqeehekahsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgi
    wqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtdngsn
    ftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmav
    fihnhkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdpvwkgpak
    llwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedley
    

    Sequence, based on observed residues (ATOM records):
    >5hotA (A:)
    cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
    dngsnftsttvkaacwwagikqefqsqgviesmnkelkkiigqvrdqaehlktavqmavf
    ihnhkrkysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdpvwkgpakllwkge
    gavviqdnsdikvvprrkakiirdygkqm
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hotB (B:)
    hldgidkaqeehekahsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgi
    wqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtdngsn
    ftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmav
    fihnhkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdpvwkgpak
    llwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedley
    

    Sequence, based on observed residues (ATOM records):
    >5hotB (B:)
    cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
    dngsnftsttvkaacwwagikqenpqsqgviesmnkelkkiigqvrdqaehlktavqmav
    fihnhkriggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdpvwkgpakllw
    kgegavviqdnsdikvvprrkakiirdygkqma