PDB entry 5hok

View 5hok on RCSB PDB site
Description: mamb-ctd mutant - d247a
Deposited on 2016-01-19, released 2017-02-01
The last revision was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Magnetosome protein MamB
    Species: Magnetospira sp. QH-2 [TaxId:1288970]
    Gene: mamB, MGMAQ_1061
    Database cross-references and differences (RAF-indexed):
    • Uniprot W6KHH6 (4-End)
      • expression tag (1-3)
      • engineered mutation (38)
  • Chain 'B':
    Compound: Magnetosome protein MamB
    Species: Magnetospira sp. QH-2 [TaxId:1288970]
    Gene: mamB, MGMAQ_1061
    Database cross-references and differences (RAF-indexed):
    • Uniprot W6KHH6 (4-End)
      • expression tag (0-3)
      • engineered mutation (38)
  • Chain 'C':
    Compound: Magnetosome protein MamB
    Species: Magnetospira sp. QH-2 [TaxId:1288970]
    Gene: mamB, MGMAQ_1061
    Database cross-references and differences (RAF-indexed):
    • Uniprot W6KHH6 (4-End)
      • expression tag (1-3)
      • engineered mutation (38)
  • Chain 'D':
    Compound: Magnetosome protein MamB
    Species: Magnetospira sp. QH-2 [TaxId:1288970]
    Gene: mamB, MGMAQ_1061
    Database cross-references and differences (RAF-indexed):
    • Uniprot W6KHH6 (4-End)
      • expression tag (0-3)
      • engineered mutation (38)
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hokA (A:)
    gshmndvlvdayniakdsqhvhgvhyirgrnvgedvhlainiyvdadlkvfesdlvadai
    rrkieaevdhvrdvhvgvtpvriaa
    

    Sequence, based on observed residues (ATOM records):
    >5hokA (A:)
    shmndvlvdayniakdsqhvhgvhyirgrnvgedvhlainiyvdadlkvfesdlvadair
    rkieaevdhvrdvhvgvtpvria
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hokB (B:)
    gshmndvlvdayniakdsqhvhgvhyirgrnvgedvhlainiyvdadlkvfesdlvadai
    rrkieaevdhvrdvhvgvtpvriaa
    

    Sequence, based on observed residues (ATOM records):
    >5hokB (B:)
    gshmndvlvdayniakdsqhvhgvhyirgrnvgedvhlainiyvdadlkvfesdlvadai
    rrkieaevdhvrdvhvgvtpvria
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hokC (C:)
    gshmndvlvdayniakdsqhvhgvhyirgrnvgedvhlainiyvdadlkvfesdlvadai
    rrkieaevdhvrdvhvgvtpvriaa
    

    Sequence, based on observed residues (ATOM records):
    >5hokC (C:)
    shmndvlvdayniakdsqhvhgvhyirgrnvgedvhlainiyvdadlkvfesdlvadair
    rkieaevdhvrdvhvgvtpvr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hokD (D:)
    gshmndvlvdayniakdsqhvhgvhyirgrnvgedvhlainiyvdadlkvfesdlvadai
    rrkieaevdhvrdvhvgvtpvriaa
    

    Sequence, based on observed residues (ATOM records):
    >5hokD (D:)
    gshmndvlvdayniakdsqhvhgvhyirgrnvgedvhlainiyvdadlkvfesdlvadai
    rrkieaevdhvrdvhvgvtpvria