PDB entry 5hoc

View 5hoc on RCSB PDB site
Description: p73 homo-tetramerization domain mutant II
Class: transcription
Keywords: transcription factor, tetramerization domain, p73, homo-tetramerization mutant, hetero-tetramerization, transcription
Deposited on 2016-01-19, released 2016-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: TP73, P73
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350
      • engineered mutation (14)
      • engineered mutation (21)
      • engineered mutation (24)
      • engineered mutation (41)
    Domains in SCOPe 2.06: d5hoca_
  • Chain 'B':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: TP73, P73
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350 (2-End)
      • engineered mutation (14)
      • engineered mutation (21)
      • engineered mutation (24)
      • engineered mutation (41)
    Domains in SCOPe 2.06: d5hocb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hocA (A:)
    gsdedtyylqvrgrrnfeilmelkrslelmelvpqplvdsydqqqqllqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hocA (A:)
    tyylqvrgrrnfeilmelkrslelmelvpqplvdsydqqqqllq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hocB (B:)
    gsdedtyylqvrgrrnfeilmelkrslelmelvpqplvdsydqqqqllqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hocB (B:)
    dedtyylqvrgrrnfeilmelkrslelmelvpqplvdsydqqqq