PDB entry 5ho8

View 5ho8 on RCSB PDB site
Description: discovery of novel 7-azaindoles as pdk1 inhibitors
Class: transferase
Keywords: PDK1 inhibitor, transferase
Deposited on 2016-01-19, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PDPK1, PDK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ho8a_
  • Heterogens: 63E, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ho8A (A:)
    mdgtaaeprpgagslqhaqpppqprkkrpedfkfgkilgegsfstvvlarelatsreyai
    kilekrhiikenkvpyvtrerdvmsrldhpffvklyftfqddeklyfglsyakngellky
    irkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitdfgtakvl
    speskqaransfvgtaqyvspellteksackssdlwalgciiyqlvaglppfragneyli
    fqkiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffesvtwenl
    hqqtppklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ho8A (A:)
    ppqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtre
    rdvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeiv
    saleylhgkgiihrdlkpenillnedmhiqitdfgtakvlssfvgtaqyvspellteksa
    ckssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvl
    datkrlgceemegygplkahpffesvtwenlhqqtppkl