PDB entry 5ho6

View 5ho6 on RCSB PDB site
Description: crystal structure of cmet in complex with cmpd.
Class: transferase
Keywords: transferase
Deposited on 2016-01-19, released 2016-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581
      • engineered mutation (145)
    Domains in SCOPe 2.06: d5ho6a_
  • Heterogens: 63K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ho6A (A:)
    ntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihca
    vkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnf
    irnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglard
    mydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvn
    tfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigeh
    yvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ho6A (A:)
    vqavqhvvigpcvyhgtlihcavksvsqfltegiimkdfshpnvlsllgicgsplvvlpy
    mkhgdlrnfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvk
    vadfglarlpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyl
    lqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnaty