PDB entry 5ho5

View 5ho5 on RCSB PDB site
Description: mamb
Deposited on 2016-01-19, released 2017-02-01
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Magnetosome protein MamB
    Species: Magnetospira sp. QH-2 [TaxId:1288970]
    Gene: mamB, MGMAQ_1061
    Database cross-references and differences (RAF-indexed):
    • Uniprot W6KHH6 (4-83)
      • expression tag (1-3)
  • Chain 'B':
    Compound: Magnetosome protein MamB
    Species: Magnetospira sp. QH-2 [TaxId:1288970]
    Gene: mamB, MGMAQ_1061
    Database cross-references and differences (RAF-indexed):
    • Uniprot W6KHH6 (4-83)
      • expression tag (0-3)
  • Chain 'C':
    Compound: Magnetosome protein MamB
    Species: Magnetospira sp. QH-2 [TaxId:1288970]
    Gene: mamB, MGMAQ_1061
    Database cross-references and differences (RAF-indexed):
    • Uniprot W6KHH6 (4-End)
      • expression tag (1-3)
  • Chain 'D':
    Compound: Magnetosome protein MamB
    Species: Magnetospira sp. QH-2 [TaxId:1288970]
    Gene: mamB, MGMAQ_1061
    Database cross-references and differences (RAF-indexed):
    • Uniprot W6KHH6 (4-83)
      • expression tag (0-3)
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ho5A (A:)
    gshmndvlvdayniakdsqhvhgvhyirgrnvgedvhldiniyvdadlkvfesdlvadai
    rrkieaevdhvrdvhvgvtpvriaa
    

    Sequence, based on observed residues (ATOM records):
    >5ho5A (A:)
    shmndvlvdayniakdsqhvhgvhyirgrnvgedvhldiniyvdadlkvfesdlvadair
    rkieaevdhvrdvhvgvtpvria
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ho5B (B:)
    gshmndvlvdayniakdsqhvhgvhyirgrnvgedvhldiniyvdadlkvfesdlvadai
    rrkieaevdhvrdvhvgvtpvriaa
    

    Sequence, based on observed residues (ATOM records):
    >5ho5B (B:)
    gshmndvlvdayniakdsqhvhgvhyirgrnvgedvhldiniyvdadlkvfesdlvadai
    rrkieaevdhvrdvhvgvtpvria
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5ho5C (C:)
    gshmndvlvdayniakdsqhvhgvhyirgrnvgedvhldiniyvdadlkvfesdlvadai
    rrkieaevdhvrdvhvgvtpvriaa
    

    Sequence, based on observed residues (ATOM records):
    >5ho5C (C:)
    shmndvlvdayniakdsqhvhgvhyirgrnvgedvhldiniyvdadlkvfesdlvadair
    rkieaevdhvrdvhvgvtpvr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5ho5D (D:)
    gshmndvlvdayniakdsqhvhgvhyirgrnvgedvhldiniyvdadlkvfesdlvadai
    rrkieaevdhvrdvhvgvtpvriaa
    

    Sequence, based on observed residues (ATOM records):
    >5ho5D (D:)
    gshmndvlvdayniakdsqhvhgvhyirgrnvgedvhldiniyvdadlkvfesdlvadai
    rrkieaevdhvrdvhvgvtpvria