PDB entry 5hns

View 5hns on RCSB PDB site
Description: structure of glycosylated npc1 luminal domain c
Deposited on 2016-01-18, released 2016-02-10
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Niemann-Pick C1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NPC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Niemann-Pick C1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NPC1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, SCN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hnsA (A:)
    etgqarlekeyfdqhfgpffrteqliirapltdkhiyqpypsgadvpfgppldiqilhqv
    ldlqiaienitasydnetvtlqdiclaplspyntnctilsvlnyfqnshsvldhkkgddf
    fvyadyhthflycvrapaslndtsllhdpclgtfggpvfpwlvlggyddqnynnatalvi
    tfpvnnyyndteklqraqawekefinfvknyknpnltisftaersiedelnresdtgtle
    vlfq
    

    Sequence, based on observed residues (ATOM records):
    >5hnsA (A:)
    keyfdqhfgpffrteqliirapltdkhiyqpypsgadvpfgppldiqilhqvldlqiaie
    nitasydnetvtlqdiclaplspyntnctilsvlnyfqnshsvldhkkgddffvyadyht
    hflycvrapaslndtsllhdpclgtfggpvfpwlvlggyddqnynnatalvitfpvnnyy
    ndteklqraqawekefinfvknyknpnltisftae
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hnsB (B:)
    etgqarlekeyfdqhfgpffrteqliirapltdkhiyqpypsgadvpfgppldiqilhqv
    ldlqiaienitasydnetvtlqdiclaplspyntnctilsvlnyfqnshsvldhkkgddf
    fvyadyhthflycvrapaslndtsllhdpclgtfggpvfpwlvlggyddqnynnatalvi
    tfpvnnyyndteklqraqawekefinfvknyknpnltisftaersiedelnresdtgtle
    vlfq
    

    Sequence, based on observed residues (ATOM records):
    >5hnsB (B:)
    ekeyfdqhfgpffrteqliirapltdkhiyqpypsgadvpfgppldiqilhqvldlqiai
    enitasydnetvtlqdiclaplspyntnctilsvlnyfqnshsvldhkkgddffvyadyh
    thflycvrapaslndtsllhdpclgtfggpvfpwlvlggyddqnynnatalvitfpvnny
    yndteklqraqawekefinfvknyknpnltisftae