PDB entry 5hnr

View 5hnr on RCSB PDB site
Description: The X-ray structure of octameric human native 5-aminolaevulinic acid dehydratase.
Class: lyase
Keywords: Tetrapyrrole biosynthesis enzyme, TIM barrel, substrate complex., LYASE
Deposited on 2016-01-18, released 2016-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hnra_
  • Chain 'B':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hnrb_
  • Heterogens: ZN, SO4, DAV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hnrA (A:)
    mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
    vclcpytshghcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaike
    almahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdr
    dvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaav
    leamtafrragadiiityytpqllqwlkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hnrA (A:)
    mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
    vclcpytshghcgllsgafraeesrqrlaevalayakagcqvvapsdmmdgrveaikeal
    mahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdrdv
    regadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaavle
    amtafrragadiiityytpqllqwlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hnrB (B:)
    mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
    vclcpytshghcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaike
    almahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdr
    dvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaav
    leamtafrragadiiityytpqllqwlkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hnrB (B:)
    mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkadseespaieaihllrktfpnllvacdvclcpy
    aeesrqrlaevalayakagcqvvapsdmmdgrveaikealmahglgnrvsvmsysakfas
    cfygpfrdaarrcyqlppgarglalravdrdvregadmlmvkpgmpyldivrevkdkhpd
    lplavyhvsgefamlwhgaqagafdlkaavleamtafrragadiiityytpqllqwlk