PDB entry 5hno

View 5hno on RCSB PDB site
Description: the structure of the kdo-capped saccharide binding subunit of the o-12 specific abc transporter, wzt
Deposited on 2016-01-18, released 2016-03-09
The last revision was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC type transport system putative ATP binding protein
    Species: Raoultella terrigena [TaxId:577]
    Gene: wzt
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6U8B1
      • conflict (97-98)
      • conflict (100-101)
      • conflict (103-109)
  • Chain 'B':
    Compound: ABC type transport system putative ATP binding protein
    Species: Raoultella terrigena [TaxId:577]
    Gene: wzt
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6U8B1 (Start-188)
      • conflict (97-98)
      • conflict (100-101)
      • conflict (103-109)
  • Chain 'C':
    Compound: ABC type transport system putative ATP binding protein
    Species: Raoultella terrigena [TaxId:577]
    Gene: wzt
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6U8B1
      • conflict (97-98)
      • conflict (100-101)
      • conflict (103-109)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hnoA (A:)
    mhhhhhhenlyfqgadqgsaeevsveelkaiqlrttneatgekrfgsaraiiedltiyks
    dgttlaekpliksgeevtfdftilaseeikdialgismskaqggdiwgdsnigagsaitl
    rpgrqrivykatlpinsgdylihcglakvgngdreeldqrrpmmkvkfwsarelggviha
    plkiisnges
    

    Sequence, based on observed residues (ATOM records):
    >5hnoA (A:)
    eevsveelkaiqlrttneatgekrfgsaraiiedltiyksdgttlaekpliksgeevtfd
    ftilaseeikdialgismskaqggdiwgdsnigagsaitlrpgrqrivykatlpinsgdy
    lihcglakvgreeldqrrpmmkvkfwsarelggvihaplkiisn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hnoB (B:)
    mhhhhhhenlyfqgadqgsaeevsveelkaiqlrttneatgekrfgsaraiiedltiyks
    dgttlaekpliksgeevtfdftilaseeikdialgismskaqggdiwgdsnigagsaitl
    rpgrqrivykatlpinsgdylihcglakvgngdreeldqrrpmmkvkfwsarelggviha
    plkiisnges
    

    Sequence, based on observed residues (ATOM records):
    >5hnoB (B:)
    evsveelkaiqlrttneatgekrfgsaraiiedltiyksdgttlaekpliksgeevtfdf
    tilaseeikdialgismskaqggdiwgdsnigagsaitlrpgrqrivykatlpinsgdyl
    ihcglakvgngdreeldqrrpmmkvkfwsarelggvihaplkiisnge
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hnoC (C:)
    mhhhhhhenlyfqgadqgsaeevsveelkaiqlrttneatgekrfgsaraiiedltiyks
    dgttlaekpliksgeevtfdftilaseeikdialgismskaqggdiwgdsnigagsaitl
    rpgrqrivykatlpinsgdylihcglakvgngdreeldqrrpmmkvkfwsarelggviha
    plkiisnges
    

    Sequence, based on observed residues (ATOM records):
    >5hnoC (C:)
    eevsveelkaiqlrttneatgekrfgsaraiiedltiyksdgttlaekpliksgeevtfd
    ftilaseeikdialgismskaqggdiwgdsnigagsaitlrpgrqrivykatlpinsgdy
    lihcglakvgngdreeldqrrpmmkvkfwsarelggvihaplkiis