PDB entry 5hni

View 5hni on RCSB PDB site
Description: CRYSTAL STRUCTURE OF CMET WT with compound 3
Class: transferase
Keywords: transferase
Deposited on 2016-01-18, released 2016-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581
      • conflict (145)
    Domains in SCOPe 2.06: d5hnix_
  • Chain 'Y':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581
      • conflict (145)
    Domains in SCOPe 2.06: d5hniy_
  • Heterogens: 63B, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5hniX (X:)
    ntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihca
    vkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnf
    irnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglard
    mydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvn
    tfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigeh
    yvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hniX (X:)
    vqavqhvvigpgcvyhgtlkihcavksvsqfltegiimkdfshpnvlsllgiclrsegsp
    lvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmld
    ekftvkvadfglardmywmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfd
    itvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvh
    vnaty
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >5hniY (Y:)
    ntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihca
    vkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnf
    irnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglard
    mydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvn
    tfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigeh
    yvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hniY (Y:)
    vqavqhvvigpgcvyhgtlkihcavksvsqfltegiimkdfshpnvlsllgiclrsegsp
    lvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmld
    ekftvkvadfglardmywmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfd
    itvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvh
    vnaty