PDB entry 5hnh

View 5hnh on RCSB PDB site
Description: crystal structure of pyrene- and phenanthrene-modified dna in complex with the bpuj1 endonuclease binding domain
Deposited on 2016-01-18, released 2016-08-17
The last revision was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: restriction endonuclease r.bpuji
    Species: Bacillus pumilus [TaxId:1408]
    Gene: bpuJIR
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: DNA (5'-d(*gp*(ypy)p*ap*cp*cp*cp*gp*tp*gp*gp*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'M':
    Compound: DNA (5'-d(*tp*cp*cp*ap*cp*gp*gp*gp*t*(ypy)*(ypy)*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hnhA (A:)
    gshmnynpeeqfrctiirgkaknmldnllpayaniiddicpcdkasfvkdfnnrlieilg
    eettkktldnhrteiagklfgmfyeddevifpsgrtnkyiedsdqpaffkdicfkfqfpn
    gmdkldkviekvgakiqirqfpyilqvlltadnnniqlskddiayyvlnslqvlqgkikp
    ieviekiiedrsnditkkvrhpgketsysmqhireqlnylelanliridgnlvklnyrea
    eninyiaqfwgnkpefnaykydftseddkksffkdwqqyysnvnshks
    

    Sequence, based on observed residues (ATOM records):
    >5hnhA (A:)
    nynpeeqfrctiirgkaknmldnllpayaniiddicpcdkasfvkdfnnrlieilgeett
    kktldnhrteiagklfgmfyeddevifpsgrtnkyiedsdqpaffkdicfkfqfpngmdk
    ldkviekvgakiqirqfpyilqvlltadnnniqlskddiayyvlnslqvlqgkikpievi
    ekiiedrsnditkkvrhpgketsysmqhireqlnylelanliridgnlvklnyreaenin
    yiaqfwgnkpefnaykydftseddkksffkdwqqyysnv
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.