PDB entry 5hnb

View 5hnb on RCSB PDB site
Description: cdk8-cycc in complex with [6-hydroxy-3-(3-methyl-benzyl)-1h-indazol-5- yl]-((s)-3-hydroxy-pyrrolidin-1-yl)-methanone
Deposited on 2016-01-18, released 2016-04-27
The last revision was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclin-dependent kinase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49336 (3-End)
      • expression tag (0-2)
  • Chain 'B':
    Compound: Cyclin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24863 (2-265)
      • expression tag (0-1)
  • Heterogens: 62M, FMT, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hnbA (A:)
    ddkmdydfkvklsserervedlfeyegckvgrgtyghvykakrkdgkddkdyalkqiegt
    gismsacreiallrelkhpnvislqkvflshadrkvwllfdyaehdlwhiikfhraskan
    kkpvqlprgmvksllyqildgihylhanwvlhrdlkpanilvmgegpergrvkiadmgfa
    rlfnsplkpladldpvvvtfwyrapelllgarhytkaidiwaigcifaelltsepifhcr
    qediktsnpyhhdqldrifnvmgfpadkdwedikkmpehstlmkdfrrntytncslikym
    ekhkvkpdskafhllqklltmdpikritseqamqdpyfledplptsdvfagcqipypkre
    flteepplkk
    

    Sequence, based on observed residues (ATOM records):
    >5hnbA (A:)
    ddkmdydfkvklsserervedlfeyegckvgrgtyghvykakrkdgkddkdyalkqiegt
    gismsacreiallrelkhpnvislqkvflshadrkvwllfdyaehdlwhiikfhraskal
    prgmvksllyqildgihylhanwvlhrdlkpanilvmgegpergrvkiadmgfarlfnsp
    lktfwyrapelllgarhytkaidiwaigcifaelltsepifhcrqesnpyhhdqldrifn
    vmgfpadkdwedikkmpehstlmkdfrrntytncslikymekhkvkpdskafhllqkllt
    mdpikritseqamqdpyfledplptsdvfagcqipypkrefl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5hnbB (B:)
    kamagnfwqsshylqwildkqdllkerqkdlkflseeeywklqifftnviqalgehlklr
    qqviatatvyfkrfyaryslksidpvlmaptcvflaskveefgvvsntrliaaatsvlkt
    rfsyafpkefpyrmnhilecefyllelmdcclivyhpyrpllqyvqdmgqedmllplawr
    ivndtyrtdlcllyppfmialaclhvacvvqqkdarqwfaelsvdmekileiirvilkly
    eqwknfderkematilskmpkpkppp