PDB entry 5hn8

View 5hn8 on RCSB PDB site
Description: crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase complexed with bph-1182
Deposited on 2016-01-18, released 2016-09-07
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyl pyrophosphate synthase, putative
    Species: Plasmodium vivax [TaxId:126793]
    Gene: PVX_092040
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5K4U6
      • see remark 999 (112)
      • see remark 999 (205)
  • Chain 'B':
    Compound: Farnesyl pyrophosphate synthase, putative
    Species: Plasmodium vivax [TaxId:126793]
    Gene: PVX_092040
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5K4U6
      • see remark 999 (112)
      • see remark 999 (205)
  • Chain 'C':
    Compound: Farnesyl pyrophosphate synthase, putative
    Species: Plasmodium vivax [TaxId:126793]
    Gene: PVX_092040
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5K4U6
      • see remark 999 (112)
      • see remark 999 (205)
  • Chain 'D':
    Compound: Farnesyl pyrophosphate synthase, putative
    Species: Plasmodium vivax [TaxId:126793]
    Gene: PVX_092040
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5K4U6
      • see remark 999 (112)
      • see remark 999 (205)
  • Heterogens: HXK, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hn8A (A:)
    mketnseeadsglaffrnmydkyrdaflshlneysleeeikehiskyykllfdynclggk
    nnrgilviliyeyvknrdinssewekaaclawcieilqaaflvaddimdkgemrrnkycw
    yllkdvetknavndvlllynsiyklieiylrnescyvdviatfrdatlktiigqhldtni
    fsdkysdahreidvnninvpeqpvidinminfgvyknivihktayysfflpivcgmllag
    iavdnliykkiedismlmgeyfqihddyldifgdstktgkvgsdiqnnkltwpliktfel
    csepdkikivknygknnlacvkvidslyeqykirkhyesyekaqkakilsainelhhegi
    eyvlkylleilftgv
    

    Sequence, based on observed residues (ATOM records):
    >5hn8A (A:)
    laffrnmydkyrdaflshlneysleeeikehiskyykllfdynclggknnrgilviliye
    yinssewekaaclawcieilqaaflvaddimdkgemrrnkycwyllkdvetknavndvll
    lynsiyklieiylrnescyvdviatfrdatlktiigqhldtnifsdkysdidvnninvpe
    qpvidinminfgvyknivihktayysfflpivcgmllagidnliykkiedismlmgeyfq
    ihddyldsdiqnnkltwpliktfelcpdkiivknygkvidslyeqykhyesyekaqkaki
    lsaielhhegieyvlkyllei
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hn8B (B:)
    mketnseeadsglaffrnmydkyrdaflshlneysleeeikehiskyykllfdynclggk
    nnrgilviliyeyvknrdinssewekaaclawcieilqaaflvaddimdkgemrrnkycw
    yllkdvetknavndvlllynsiyklieiylrnescyvdviatfrdatlktiigqhldtni
    fsdkysdahreidvnninvpeqpvidinminfgvyknivihktayysfflpivcgmllag
    iavdnliykkiedismlmgeyfqihddyldifgdstktgkvgsdiqnnkltwpliktfel
    csepdkikivknygknnlacvkvidslyeqykirkhyesyekaqkakilsainelhhegi
    eyvlkylleilftgv
    

    Sequence, based on observed residues (ATOM records):
    >5hn8B (B:)
    affrnmydkyrdaflshlneysleeeikehiskyykllfdynclggknnrgilviliyey
    vkdinssewekaaclawcieilqaaflvaddimdkgemrrnkycwyllkdvetknavndv
    lllynsiyklieiylrnescyvdviatfrdatlktiigqhldtnifsdkyreidvnninp
    vidinminfgvyknivihktayysfflpivcgmllagidnliykkiedismlmgeyfqih
    ddyldinnkltwpliktfelcsepdkikivknygnlakvidslyeqykirkhyesyekaq
    kakilsainelhhegieyvlkyllei
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hn8C (C:)
    mketnseeadsglaffrnmydkyrdaflshlneysleeeikehiskyykllfdynclggk
    nnrgilviliyeyvknrdinssewekaaclawcieilqaaflvaddimdkgemrrnkycw
    yllkdvetknavndvlllynsiyklieiylrnescyvdviatfrdatlktiigqhldtni
    fsdkysdahreidvnninvpeqpvidinminfgvyknivihktayysfflpivcgmllag
    iavdnliykkiedismlmgeyfqihddyldifgdstktgkvgsdiqnnkltwpliktfel
    csepdkikivknygknnlacvkvidslyeqykirkhyesyekaqkakilsainelhhegi
    eyvlkylleilftgv
    

    Sequence, based on observed residues (ATOM records):
    >5hn8C (C:)
    frnmydkyrdaflshlneeeeikehiskyykllfdynclggknnrgilviliyeyvinss
    ewekaaclawcieilqaaflvaddimdkgemrrnkycwyllkdvetknavndvlllynsi
    yklieiylrnescyvdviatfrdatlktiigqhldtnifsdkydareidvnninvpeqpv
    idinminfgvyknivihktayysfflpivcgmllagidnliykkiedismlmgeyfqihd
    dyldifsdiqnnkltwpliktfelcsepdkikivknygknnlacvkvidslyqykirkhy
    esyekaqkakilsainelhhegieyvlkylleil
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hn8D (D:)
    mketnseeadsglaffrnmydkyrdaflshlneysleeeikehiskyykllfdynclggk
    nnrgilviliyeyvknrdinssewekaaclawcieilqaaflvaddimdkgemrrnkycw
    yllkdvetknavndvlllynsiyklieiylrnescyvdviatfrdatlktiigqhldtni
    fsdkysdahreidvnninvpeqpvidinminfgvyknivihktayysfflpivcgmllag
    iavdnliykkiedismlmgeyfqihddyldifgdstktgkvgsdiqnnkltwpliktfel
    csepdkikivknygknnlacvkvidslyeqykirkhyesyekaqkakilsainelhhegi
    eyvlkylleilftgv
    

    Sequence, based on observed residues (ATOM records):
    >5hn8D (D:)
    laffrnmydkyrdaflshlneysleeeikehisyykllfdynclggknnrgilviliyey
    vinssewekaaclawcieilqaaflvaddimdkgemrrnkycwyllkdvetknavndvll
    lynsiyklieiylrnescyvdviatfrdatlktiigqhldtnifsdkyseidvnninvpp
    vidinminfgvyknivihktayysfflpivcgmllagidnliykkiedismlmgeyfqih
    ddylsdiqnnkltwpliktfelcsepdkikivknygknnlacvkvidslyeqykirkhye
    syekaqkakilsainelhhegieyvlkylleilf