PDB entry 5hn6

View 5hn6 on RCSB PDB site
Description: Crystal structure of beta-decarboxylating dehydrogenase (TK0280) from Thermococcus kodakarensis complexed with Mn and 3-isopropylmalate
Class: oxidoreductase
Keywords: homoisocitrate dehydrogenase, beta-decarboxylating dehydrogenase, OXIDOREDUCTASE
Deposited on 2016-01-18, released 2016-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-04, with a file datestamp of 2016-12-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homoisocitrate dehydrogenase
    Species: Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) [TaxId:69014]
    Gene: TK0280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hn6a_
  • Heterogens: IPM, MN, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hn6A (A:)
    myrvavipgdgigpevidgavrvlkavtgrvrfeyyeggvdvfqecgspireedleeirr
    sdavlfgatttpfdlpgyrsliltlrkelglyanlriipdlrtgreivivrenseglyfg
    igavvngravdvrlitregaeriarfaveqakargsfitfvhkanvltgdkffrrivrev
    ageegvevrdaiidsftiklvrnpwehgvilsenlfgdilsdlatvhagsigivpsgnyg
    dgialfepvhgsapdiagkgianpigailsgamlldylgldgsliraavrgyvvngeltp
    dmggrartedvvrgiigeiedllsmdevwrdeirlsrlesdisrmaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hn6A (A:)
    myrvavipgdgigpevidgavrvlkavtgrvrfeyyeggvdvfqecgspireedleeirr
    sdavlfgatttpfdlpgyrsliltlrkelglyanlriipdlrtgreivivrenseglyfg
    igavvngravdvrlitregaeriarfaveqakargsfitfvhkanvltgdkffrrivrev
    ageegvevrdaiidsftiklvrnpwehgvilsenlfgdilsdlatvhagsigivpsgnyg
    dgialfepvhgsapdiagkgianpigailsgamlldylgldgsliraavrgyvvngeltp
    dmggrartedvvrgiigeiedllsmdevw