PDB entry 5hml

View 5hml on RCSB PDB site
Description: Crystal Structure of T5 D15 Protein Co-crystallized with Metal Ions
Class: hydrolase
Keywords: Metal ion complex, flap endonuclease, alternative conformations, hydrolase
Deposited on 2016-01-16, released 2016-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease
    Species: ESCHERICHIA PHAGE T5 [TaxId:10726]
    Gene: D15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06229 (0-End)
      • engineered mutation (133)
    Domains in SCOPe 2.06: d5hmla1, d5hmla2
  • Chain 'B':
    Compound: exodeoxyribonuclease
    Species: ESCHERICHIA PHAGE T5 [TaxId:10726]
    Gene: D15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06229 (0-End)
      • engineered mutation (133)
    Domains in SCOPe 2.06: d5hmlb1, d5hmlb2
  • Heterogens: MG, CL, EDO, B3P, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hmlA (A:)
    rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
    peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
    ighlydhvwlistkgdwdtlltdkvsrfsfttrreyhlrdmyehhnvddveqfislkaim
    gdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqnlnaseellfrnlil
    vdlptycvdaiaavgqdvldkftkdileiaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hmlA (A:)
    rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
    peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
    ighlydhvwlistkgdwdtlltdkvsrfsfttrreyhlrdmyehhnvddveqfislkaim
    gdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqnlnaseellfrnlil
    vdlptycvdaiaavgqdvldkftkdileiae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hmlB (B:)
    rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
    peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
    ighlydhvwlistkgdwdtlltdkvsrfsfttrreyhlrdmyehhnvddveqfislkaim
    gdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqnlnaseellfrnlil
    vdlptycvdaiaavgqdvldkftkdileiaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hmlB (B:)
    rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
    peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
    ighlydhvwlistkgdwdtlltdkvsrfsfttrreyhlrdmyehhnvddveqfislkaim
    gdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqnlnaseellfrnlil
    vdlptycvdaiaavgqdvldkftkdileiae