PDB entry 5hmk

View 5hmk on RCSB PDB site
Description: HDM2 in complex with a 3,3-Disubstituted Piperidine
Class: ligase/ligase inhibitor
Keywords: Oncology, E3 ubiquitin-protein ligase, p53/TP53, ligase-ligase inhibitor complex
Deposited on 2016-01-16, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987
      • engineered mutation (38)
      • engineered mutation (59)
    Domains in SCOPe 2.07: d5hmka_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987
      • engineered mutation (38)
      • engineered mutation (59)
    Domains in SCOPe 2.07: d5hmkb_
  • Heterogens: 62Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hmkA (A:)
    sqipaseqetlvrpkplllkllksvgaqkdtytmkevlyylgqyimtkrlydekqqhivh
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hmkA (A:)
    tlvrpkplllkllksvgaqkdtytmkevlyylgqyimtkrlydekqqhivhcsndllgdl
    fgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hmkB (B:)
    sqipaseqetlvrpkplllkllksvgaqkdtytmkevlyylgqyimtkrlydekqqhivh
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hmkB (B:)
    aseqetlvrpkplllkllksvgaqkdtytmkevlyylgqyimtkrlydekqqhivhcsnd
    llgdlfgvpsfsvkehrkiytmiyrnlvvvn