PDB entry 5hmh

View 5hmh on RCSB PDB site
Description: HDM2 in complex with a 3,3-Disubstituted Piperidine
Class: ligase/ligase inhibitor
Keywords: Oncology, E3 ubiquitin-protein ligase, p53/TP53, ligase-ligase inhibitor complex
Deposited on 2016-01-16, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (2-End)
      • expression tag (0-1)
      • engineered mutation (36)
      • engineered mutation (57)
    Domains in SCOPe 2.07: d5hmha1, d5hmha2
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (2-97)
      • engineered mutation (36)
      • engineered mutation (57)
      • expression tag (98-100)
    Domains in SCOPe 2.07: d5hmhb1, d5hmhb2
  • Heterogens: 62R, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hmhA (A:)
    asaseqetlvrpkplllkllksvgaqkdtytmkevlyylgqyimtkrlydekqqhivhcs
    ndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hmhA (A:)
    asaseqetlvrpkplllkllksvgaqkdtytmkevlyylgqyimtkrlydekqqhivhcs
    ndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hmhB (B:)
    asaseqetlvrpkplllkllksvgaqkdtytmkevlyylgqyimtkrlydekqqhivhcs
    ndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hmhB (B:)
    aseqetlvrpkplllkllksvgaqkdtytmkevlyylgqyimtkrlydekqqhivhcsnd
    llgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessaga