PDB entry 5hmf

View 5hmf on RCSB PDB site
Description: crystal structure of triazine hydrolase variant (p214t/y215h/e241q)
Deposited on 2016-01-16, released 2016-11-02
The last revision was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triazine hydrolase
    Species: Arthrobacter aurescens [TaxId:43663]
    Gene: trzN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6SJY7 (0-End)
      • conflict (39)
      • conflict (132)
      • conflict (160)
      • engineered mutation (215-216)
      • engineered mutation (242)
      • conflict (304)
  • Chain 'B':
    Compound: Triazine hydrolase
    Species: Arthrobacter aurescens [TaxId:43663]
    Gene: trzN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6SJY7
      • conflict (39)
      • conflict (132)
      • conflict (160)
      • engineered mutation (215-216)
      • engineered mutation (242)
      • conflict (304)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hmfA (A:)
    ermilirgltrvitfddqereledadilidgpkivavgknlsdrsvsrtidgrgmialpg
    linshqhlyegamraipqlervtmaswlegvltrsagwwrdgkfgpdvirevaravlles
    llggittvadqhpffpgatadsyidatieaatdlgirfhavrssmtlgkseggfcddlfv
    epvdrvvqhclglidqyhepepfgmvrialgpcgvthdkpelfeafaqmaadydvrlhth
    fyqpldagmsdhlygmtpwrflekhgwasdrvwlahavvppreeipefadagvaiahlia
    pdlrlgwglapireyldagitvgfgttgsasndggnllgdlrlaalahrpadpnepekwl
    sarellrmatrgsaeclgrpdlgvleegraadiacwrldgvdrvgvhdpaiglimtglsd
    raslvvvngqvlvenerpvladlerivanttalipknl
    

    Sequence, based on observed residues (ATOM records):
    >5hmfA (A:)
    ermilirgltrvitfddqereledadilidgpkivavgknlsdrsvsrtidgrgmialpg
    linshqhlyegamraipqlervtmaswlegvltrsagwwrdgkfgpdvirevaravlles
    llggittvadqhpffpgatadsyidatieaatdlgirfhavrssmtlgkseggfcddlfv
    epvdrvvqhclglidqyhepepfgmvrialgpcgvthdkpelfeafaqmaadydvrlhth
    fyqpldagmsdhlygmtpwrflekhgwasdrvwlahavvppreeipefadagvaiahlia
    pdlrlgwglapireyldagitvgfgttgsasndggnllgdlrlaalahrpadpnepekwl
    sarellrmatrgsaeclgrpdlgvleegraadiacwrldgvdrvgvhdpaiglimtglsd
    raslvvvngqvlvenerpvladlerivanttalipk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hmfB (B:)
    ermilirgltrvitfddqereledadilidgpkivavgknlsdrsvsrtidgrgmialpg
    linshqhlyegamraipqlervtmaswlegvltrsagwwrdgkfgpdvirevaravlles
    llggittvadqhpffpgatadsyidatieaatdlgirfhavrssmtlgkseggfcddlfv
    epvdrvvqhclglidqyhepepfgmvrialgpcgvthdkpelfeafaqmaadydvrlhth
    fyqpldagmsdhlygmtpwrflekhgwasdrvwlahavvppreeipefadagvaiahlia
    pdlrlgwglapireyldagitvgfgttgsasndggnllgdlrlaalahrpadpnepekwl
    sarellrmatrgsaeclgrpdlgvleegraadiacwrldgvdrvgvhdpaiglimtglsd
    raslvvvngqvlvenerpvladlerivanttalipknl
    

    Sequence, based on observed residues (ATOM records):
    >5hmfB (B:)
    rmilirgltrvitfddqereledadilidgpkivavgknlsdrsvsrtidgrgmialpgl
    inshqhlyegamraipqlervtmaswlegvltrsagwwrdgkfgpdvirevaravllesl
    lggittvadqhpffpgatadsyidatieaatdlgirfhavrssmtlgkseggfcddlfve
    pvdrvvqhclglidqyhepepfgmvrialgpcgvthdkpelfeafaqmaadydvrlhthf
    yqpldagmsdhlygmtpwrflekhgwasdrvwlahavvppreeipefadagvaiahliap
    dlrlgwglapireyldagitvgfgttgsasndggnllgdlrlaalahrpadpnepekwls
    arellrmatrgsaeclgrpdlgvleegraadiacwrldgvdrvgvhdpaiglimtglsdr
    aslvvvngqvlvenerpvladlerivanttalipk