PDB entry 5hmb

View 5hmb on RCSB PDB site
Description: Crystal structure of S. sahachiroi AziG
Class: hydrolase
Keywords: azinomycin biosynthesis, polyketide synthase, thioesterase, naphthoate, HYDROLASE
Deposited on 2016-01-15, released 2016-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azi13
    Species: Streptomyces sahachiroi [TaxId:285525]
    Gene: azi13
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4XYA6 (Start-132)
      • expression tag (133)
    Domains in SCOPe 2.07: d5hmba1, d5hmba2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hmbA (A:)
    mtttdktdsrlgpyvehlglqferidpdravaywsvradllqphgilhggvhcavvesva
    saaadrwlgdrgtvvgvsnstdffapatvadgrltstalpvhrgatqqvwsvetvdaagr
    lvargqvrlhnlrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hmbA (A:)
    rlgpyvehlglqferidpdravaywsvradllqphgilhggvhcavvesvasaaadrwlg
    drgtvvgvsnstdffapatvadgrltstalpvhrgatqqvwsvetvdaagrlvargqvrl
    hnlrl