PDB entry 5hm1

View 5hm1 on RCSB PDB site
Description: llama vhh 2e7 in complex with gp41
Deposited on 2016-01-15, released 2017-01-25
The last revision was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lama VHH antibody 2E7
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HM1 (0-118)
  • Chain 'B':
    Compound: lama VHH antibody 2E7
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HM1 (0-118)
  • Chain 'C':
    Compound: lama VHH antibody 2E7
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HM1 (0-118)
  • Chain 'D':
    Compound: gp41
    Species: HIV-1 M:B_HXB2R, synthetic [TaxId:11706]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: gp41
    Species: HIV-1 M:B_HXB2R, synthetic [TaxId:11706]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: gp41
    Species: HIV-1 M:B_HXB2R, synthetic [TaxId:11706]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5hm1A (A:)
    dvqlqesggglvqpggslrlscaasgnivsidaagwfrqapgkqrepvatiltggatnya
    dsvkgrftisrdnakntvylqmnslkpedtavyycyapmiyyggrysdywgqgtqvtvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5hm1B (B:)
    dvqlqesggglvqpggslrlscaasgnivsidaagwfrqapgkqrepvatiltggatnya
    dsvkgrftisrdnakntvylqmnslkpedtavyycyapmiyyggrysdywgqgtqvtvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5hm1C (C:)
    dvqlqesggglvqpggslrlscaasgnivsidaagwfrqapgkqrepvatiltggatnya
    dsvkgrftisrdnakntvylqmnslkpedtavyycyapmiyyggrysdywgqgtqvtvs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5hm1D (D:)
    averylkdqqllgiw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >5hm1E (E:)
    averylkdqqllgiw
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >5hm1F (F:)
    averylkdqqllgiw