PDB entry 5hlw

View 5hlw on RCSB PDB site
Description: Crystal structure of c-Met mutant Y1230H in complex with compound 14
Class: transferase
Keywords: transferase, transferase inhibitor
Deposited on 2016-01-15, released 2016-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (0-298)
      • engineered mutation (173)
    Domains in SCOPe 2.06: d5hlwa_
  • Heterogens: CL, 62E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hlwA (A:)
    alnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnrit
    digevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnp
    tvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmhdkeyys
    vhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyl
    lqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnat
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlwA (A:)
    alnpelvqavqhvvigsslivhfnevigrhfgcvyhgtlldgkkihcavkslnridigev
    sqfltegiimkdfshpnvlsllgicsplvvlpymkhgdlrnfirnethnptvkdligfgl
    qvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmhdkeyysvaklpvkwma
    leslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdp
    lyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnat