PDB entry 5hlv

View 5hlv on RCSB PDB site
Description: Crystal structure of calcium and zinc-bound human S100A8 in space group P212121
Class: signaling protein
Keywords: S100 proteins, calcium, zinc, oligomer, signaling protein
Deposited on 2016-01-15, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5hlva1, d5hlva2
  • Chain 'B':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5hlvb1, d5hlvb2
  • Chain 'C':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hlvc_
  • Chain 'D':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5hlvd1, d5hlvd2
  • Chain 'E':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5hlve1, d5hlve2
  • Chain 'F':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5hlvf1, d5hlvf2
  • Chain 'G':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5hlvg1, d5hlvg2
  • Chain 'H':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5hlvh1, d5hlvh2
  • Heterogens: CA, ZN, ACT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hlvA (A:)
    maltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeld
    intdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlvA (A:)
    altelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hlvB (B:)
    maltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeld
    intdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlvB (B:)
    altelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hlvC (C:)
    maltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeld
    intdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlvC (C:)
    ltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldin
    tdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hlvD (D:)
    maltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeld
    intdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlvD (D:)
    altelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hlvE (E:)
    maltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeld
    intdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlvE (E:)
    altelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hlvF (F:)
    maltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeld
    intdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlvF (F:)
    altelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5hlvG (G:)
    maltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeld
    intdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlvG (G:)
    altelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshees
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5hlvH (H:)
    maltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeld
    intdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlvH (H:)
    altelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee