PDB entry 5hlu

View 5hlu on RCSB PDB site
Description: X-ray crystal structure of met F43H/H64A sperm whale myoglobin in complex with nitric oxide
Class: oxygen storage
Keywords: Myoglobin, OXYGEN STORAGE
Deposited on 2016-01-15, released 2016-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (Start-152)
      • engineered mutation (42)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5hlua_
  • Heterogens: HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hluA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekhdrfkhlkteaemkased
    lkkagvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hluA (A:)
    lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekhdrfkhlkteaemkasedl
    kkagvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpg
    dfgadaqgamnkalelfrkdiaakykelgyqg