PDB entry 5hlq

View 5hlq on RCSB PDB site
Description: X-ray crystal struture of met F43H/H64A sperm whale myoglobin
Class: oxygen storage
Keywords: myoglobin, OXYGEN STORAGE
Deposited on 2016-01-15, released 2016-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-25, with a file datestamp of 2016-05-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (Start-152)
      • engineered mutation (42)
      • engineered mutation (63)
    Domains in SCOPe 2.06: d5hlqa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hlqA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekhdrfkhlkteaemkased
    lkkagvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlqA (A:)
    lsegewqlvlhvwakveadvaghgqdilirlfkshpetlekhdrfkhlkteaemkasedl
    kkagvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpg
    dfgadaqgamnkalelfrkdiaakykelgyqg