PDB entry 5hlo

View 5hlo on RCSB PDB site
Description: Crystal structure of calcium and zinc-bound human S100A8 in space group C2221
Class: signaling protein
Keywords: S100 protein, calcium, zinc, oligomer, signaling protein
Deposited on 2016-01-15, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5hloa1, d5hloa2
  • Chain 'B':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (2-93)
      • expression tag (1)
    Domains in SCOPe 2.07: d5hlob1, d5hlob2
  • Chain 'C':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (2-93)
      • expression tag (1)
    Domains in SCOPe 2.07: d5hloc1, d5hloc2
  • Chain 'D':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (2-93)
      • expression tag (1)
    Domains in SCOPe 2.07: d5hlod1, d5hlod2
  • Heterogens: CA, ZN, CAC, CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hloA (A:)
    maltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeld
    intdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hloA (A:)
    altelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hloB (B:)
    maltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeld
    intdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hloB (B:)
    altelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hloC (C:)
    maltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeld
    intdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hloC (C:)
    altelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hloD (D:)
    maltelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeld
    intdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hloD (D:)
    altelekalnsiidvyhkyslikgnfhavyrddlkklletecpqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke