PDB entry 5hln

View 5hln on RCSB PDB site
Description: x-ray crystal structure of gsk3b in complex with chir99021
Class: transferase/transferase inhibitor
Keywords: Protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-01-15, released 2016-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hlna_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hlnb_
  • Heterogens: 65C, MG, MES

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hlnA (A:)
    gspgmsgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsy
    tdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryff
    yssgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfg
    ichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdyts
    sidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqi
    kahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdt
    palfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasa
    snst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlnA (A:)
    gskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrf
    knrelqimrkldhcnivrlryffyssdevylnlvldyvpetvyrvarhysrakqtlpviy
    vklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyi
    csryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtpt
    reqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacah
    sffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hlnB (B:)
    gspgmsgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsy
    tdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryff
    yssgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfg
    ichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdyts
    sidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqi
    kahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdt
    palfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasa
    snst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlnB (B:)
    vttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknr
    elqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpvi
    yvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsy
    icsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtp
    treqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleaca
    hsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar