PDB entry 5hlm

View 5hlm on RCSB PDB site
Description: Crystal structure of avidin complex with a ferrocene biotin derivative
Class: biotin-binding protein
Keywords: glycoprotein, complex, biotin-binding protein
Deposited on 2016-01-15, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hlma_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hlmb_
  • Chain 'C':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hlmc_
  • Chain 'D':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hlmd_
  • Heterogens: B9F, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hlmA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlmA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavtneikesplhgtqnttqptfgftvn
    wkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hlmB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlmB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavikesplhgtqntqptfgftvnwkfs
    esttvftgqcfidgkevlktmwllrssvndigddwkatrvginiftrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hlmC (C:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlmC (C:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyitavneikesplhgtqntinkrtqptfg
    ftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hlmD (D:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hlmD (D:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l