PDB entry 5hlh

View 5hlh on RCSB PDB site
Description: crystal structure of the overoxidized abfr bound to dna
Deposited on 2016-01-15, released 2017-01-25
The last revision was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MarR family Transcriptional regulator
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: ADT70_02765
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0N1EJ89 (Start-146)
      • engineered mutation (72)
  • Chain 'B':
    Compound: MarR family Transcriptional regulator
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: ADT70_02765
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0N1EJ89 (1-End)
      • engineered mutation (72)
  • Chain 'C':
    Compound: MarR family Transcriptional regulator
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: ADT70_02765
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: MarR family Transcriptional regulator
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: ADT70_02765
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0N1EJ89 (1-End)
      • engineered mutation (72)
  • Chain 'E':
    Compound: MarR family Transcriptional regulator
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: ADT70_02765
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0N1EJ89 (1-End)
      • expression tag (0)
      • engineered mutation (72)
  • Chain 'F':
    Compound: MarR family Transcriptional regulator
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: ADT70_02765
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0N1EJ89 (1-End)
      • engineered mutation (72)
  • Chain 'G':
    Compound: MarR family Transcriptional regulator
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: ADT70_02765
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: MarR family Transcriptional regulator
    Species: Staphylococcus epidermidis [TaxId:1282]
    Gene: ADT70_02765
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0N1EJ89 (1-End)
      • engineered mutation (72)
  • Chain 'I':
    Compound: DNA (5'-d(*tp*ap*ap*cp*tp*cp*ap*ap*tp*cp*gp*cp*gp*cp*gp*cp*gp*ap*tp*tp*gp*ap*gp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'J':
    Compound: DNA (5'-d(*tp*ap*ap*cp*tp*cp*ap*ap*tp*cp*gp*cp*gp*cp*gp*cp*gp*ap*tp*tp*gp*ap*gp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'K':
    Compound: DNA (5'-d(*tp*ap*ap*cp*tp*cp*ap*ap*tp*cp*gp*cp*gp*cp*gp*cp*gp*ap*tp*tp*gp*ap*gp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'L':
    Compound: DNA (5'-d(*tp*ap*ap*cp*tp*cp*ap*ap*tp*cp*gp*cp*gp*cp*gp*cp*gp*ap*tp*tp*gp*ap*gp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'M':
    Compound: DNA (5'-d(*tp*ap*ap*cp*tp*cp*ap*ap*tp*cp*gp*cp*gp*cp*gp*cp*gp*ap*tp*tp*gp*ap*gp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'N':
    Compound: DNA (5'-d(*tp*ap*ap*cp*tp*cp*ap*ap*tp*cp*gp*cp*gp*cp*gp*cp*gp*ap*tp*tp*gp*ap*gp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'O':
    Compound: DNA (5'-d(*tp*ap*ap*cp*tp*cp*ap*ap*tp*cp*gp*cp*gp*cp*gp*cp*gp*ap*tp*tp*gp*ap*gp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'P':
    Compound: DNA (5'-d(*tp*ap*ap*cp*tp*cp*ap*ap*tp*cp*gp*cp*gp*cp*gp*cp*gp*ap*tp*tp*gp*ap*gp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hlhA (A:)
    amkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsig
    rhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpq
    efdtteydetkyvfeeleqtlkhliek
    

    Sequence, based on observed residues (ATOM records):
    >5hlhA (A:)
    qeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsigrhl
    dlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaisscydetky
    vfeeleqtlkhliek
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hlhB (B:)
    amkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsig
    rhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpq
    efdtteydetkyvfeeleqtlkhliek
    

    Sequence, based on observed residues (ATOM records):
    >5hlhB (B:)
    mkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsigr
    hldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaisscleyd
    etkyvfeeleqtlkhlie
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hlhC (C:)
    amkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsig
    rhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpq
    efdtteydetkyvfeeleqtlkhliek
    

    Sequence, based on observed residues (ATOM records):
    >5hlhC (C:)
    eqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsigrhld
    lssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclydetky
    vfeeleqtlkhli
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hlhD (D:)
    amkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsig
    rhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpq
    efdtteydetkyvfeeleqtlkhliek
    

    Sequence, based on observed residues (ATOM records):
    >5hlhD (D:)
    mkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsigr
    hldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpde
    tkyvfeeleqtlkhli
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5hlhE (E:)
    amkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsig
    rhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpq
    efdtteydetkyvfeeleqtlkhliek
    

    Sequence, based on observed residues (ATOM records):
    >5hlhE (E:)
    amkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsig
    rhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpd
    etkyvfeeleqtlkhli
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5hlhF (F:)
    amkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsig
    rhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpq
    efdtteydetkyvfeeleqtlkhliek
    

    Sequence, based on observed residues (ATOM records):
    >5hlhF (F:)
    mkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsigr
    hldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclyde
    tkyvfeeleqtlkhlie
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5hlhG (G:)
    amkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsig
    rhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpq
    efdtteydetkyvfeeleqtlkhliek
    

    Sequence, based on observed residues (ATOM records):
    >5hlhG (G:)
    qeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsigrhl
    dlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaisscltkyvf
    eeleqtlkhli
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5hlhH (H:)
    amkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsig
    rhldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclpq
    efdtteydetkyvfeeleqtlkhliek
    

    Sequence, based on observed residues (ATOM records):
    >5hlhH (H:)
    mkqeqmrlanqlcfsaynvsrlfaqfyekklkqfgitysqylvlltlweenpqtlnsigr
    hldlssntltpmlkrleqsgwvkrerqqsdkrqliitltdngqqqqeavfeaissclyde
    tkyvfeeleqtlkhlie
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.