PDB entry 5hl0

View 5hl0 on RCSB PDB site
Description: crystal structure of c-cbl tkbd in complex with spry2 peptide (54-60, py55) refined to 2.2a resolution
Deposited on 2016-01-14, released 2017-01-18
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase CBL
    Species: Homo sapiens [TaxId:9606]
    Gene: CBL, CBL2, RNF55
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Sprouty 2 (SPRY2)
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HL0
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hl0A (A:)
    snappgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsrye
    gkmetlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmla
    elkgifpsglfqgdtfritkadaaefwrkafgektivpwksfrqalhevhpissgleama
    lkstidltcndyisvfefdiftrlfqpwssllrnwnslavthpgymafltydevkarlqk
    fihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkplfqalidgfregfylfpdgr
    nqnpdltg
    

    Sequence, based on observed residues (ATOM records):
    >5hl0A (A:)
    pgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkme
    tlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelkg
    ifpsglfqgdtfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkst
    idltcndyisvfefdiftrlfqpwssllrnwnslavthpgymafltydevkarlqkfihk
    pgsyifrlsctrlgqwaigyvtadgnilqtiphnkplfqalidgfregfylfpdgrnqnp
    dlt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hl0B (B:)
    eytegpt
    

    Sequence, based on observed residues (ATOM records):
    >5hl0B (B:)
    eytegp