PDB entry 5hkx

View 5hkx on RCSB PDB site
Description: crystal structure of c-cbl tkbd-ring domains (y371e mutant) refined to 1.85 a resolution
Deposited on 2016-01-14, released 2017-01-18
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase CBL
    Species: Homo sapiens [TaxId:9606]
    Gene: CBL, CBL2, RNF55
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22681
      • engineered mutation (327)
  • Heterogens: EDO, ZN, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hkxA (A:)
    snappgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsrye
    gkmetlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmla
    elkgifpsglfqgdtfritkadaaefwrkafgektivpwksfrqalhevhpissgleama
    lkstidltcndyisvfefdiftrlfqpwssllrnwnslavthpgymafltydevkarlqk
    fihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkplfqalidgfregfylfpdgr
    nqnpdltglceptpqdhikvtqeqyelecemgstfqlckicaendkdvkiepcghlmcts
    cltswqesegqgcpfcrceikgtepivvdpfd
    

    Sequence, based on observed residues (ATOM records):
    >5hkxA (A:)
    pgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkme
    tlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelkg
    ifpsglfqgdtfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkst
    idltcndyisvfefdiftrlfqpwssllrnwnslavthpgymafltydevkarlqkfihk
    pgsyifrlsctrlgqwaigyvtadgnilqtiphnkplfqalidgfregfylfpdgrnqnp
    dltglcevtqeqyelecemgstfqlckicaendkdvkiepcghlmctscltswqesegqg
    cpfcrceikgtepi