PDB entry 5hku

View 5hku on RCSB PDB site
Description: bacterial sodium channel pore domain, low bromide
Deposited on 2016-01-14, released 2016-03-09
Made obsolete by 5iwo on 2016-03-30

The last revision was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 3.33 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ion transport protein
    Species: Alkalilimnicola ehrlichii [TaxId:351052]
    Gene: Mlg_0322
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ion transport protein
    Species: Alkalilimnicola ehrlichii [TaxId:351052]
    Gene: Mlg_0322
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ion transport protein
    Species: Alkalilimnicola ehrlichii [TaxId:351052]
    Gene: Mlg_0322
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ion transport protein
    Species: Alkalilimnicola ehrlichii [TaxId:351052]
    Gene: Mlg_0322
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hkuA (A:)
    gpsspsllraipgiawiallllvifyvfavmgtklfaqsfpewfgtlgasmytlfqvmtl
    eswsmgiarpvieaypwawiyfvsfilvssftvlnlfigiiiesmqsahweaedakrieq
    eqrahderlemlqlirdlsskvdrlerrsgkr
    

    Sequence, based on observed residues (ATOM records):
    >5hkuA (A:)
    pgiawiallllvifyvfavmgtklfaqsfpewfgtlgasmytlfqvmtleswsmgiarpv
    ieaypwawiyfvsfilvssftvlnlfigiiiesmqsahweaedakrieqeqrahderlem
    lqlirdlsskvdrlerrsg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hkuB (B:)
    gpsspsllraipgiawiallllvifyvfavmgtklfaqsfpewfgtlgasmytlfqvmtl
    eswsmgiarpvieaypwawiyfvsfilvssftvlnlfigiiiesmqsahweaedakrieq
    eqrahderlemlqlirdlsskvdrlerrsgkr
    

    Sequence, based on observed residues (ATOM records):
    >5hkuB (B:)
    pgiawiallllvifyvfavmgtklfaqsfpewfgtlgasmytlfqvmtleswsmgiarpv
    ieaypwawiyfvsfilvssftvlnlfigiiiesmqsahweaedakrieqeqrahderlem
    lqlirdlsskvdrlerrs
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hkuC (C:)
    gpsspsllraipgiawiallllvifyvfavmgtklfaqsfpewfgtlgasmytlfqvmtl
    eswsmgiarpvieaypwawiyfvsfilvssftvlnlfigiiiesmqsahweaedakrieq
    eqrahderlemlqlirdlsskvdrlerrsgkr
    

    Sequence, based on observed residues (ATOM records):
    >5hkuC (C:)
    pgiawiallllvifyvfavmgtklfaqsfpewfgtlgasmytlfqvmtleswsmgiarpv
    ieaypwawiyfvsfilvssftvlnlfigiiiesmqsahweaedakrieqeqrahderlem
    lqlirdlsskvdrlerrs
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hkuD (D:)
    gpsspsllraipgiawiallllvifyvfavmgtklfaqsfpewfgtlgasmytlfqvmtl
    eswsmgiarpvieaypwawiyfvsfilvssftvlnlfigiiiesmqsahweaedakrieq
    eqrahderlemlqlirdlsskvdrlerrsgkr
    

    Sequence, based on observed residues (ATOM records):
    >5hkuD (D:)
    pgiawiallllvifyvfavmgtklfaqsfpewfgtlgasmytlfqvmtleswsmgiarpv
    ieaypwawiyfvsfilvssftvlnlfigiiiesmqsahweaedakrieqeqrahderlem
    lqlirdlsskvdrlerrs