PDB entry 5hko

View 5hko on RCSB PDB site
Description: crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. mc2 155, target efi-510969, in complex with l-sorbitol
Deposited on 2016-01-14, released 2016-02-03
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: MSMEG_3598, MSMEI_3515
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, CL, 62W, IMD, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hkoA (A:)
    mhhhhhhssgvdlgtenlyfqsmagdtaansdtkrigvtvydmssfitegkegmdtyaka
    nnielvwnsanndvstqasqvdslinqgvdaiivvpvqadslgpqvasakskgipllavn
    aaletpdlagnvqpddvaagaqemqmmadrlggkgnivilqgplggsgeinrgkgidqvl
    akypdikvlakdtanwkrdeavnkmknwissfgpqidgvvaqnddmglgalqalkeagrt
    gvpivgidgiedglnavksgdfigtslqngtvelsaglavadalvkgedvktdpvyvmpa
    itkdnvdvaiehvvterqkfldglveltqqnlktgdiayegipgqtqp
    

    Sequence, based on observed residues (ATOM records):
    >5hkoA (A:)
    tkrigvtvydmssfitegkegmdtyakannielvwnsanndvstqasqvdslinqgvdai
    ivvpvqadslgpqvasakskgipllavnaaletpdlagnvqpddvaagaqemqmmadrlg
    gkgnivilqgplggsgeinrgkgidqvlakypdikvlakdtanwkrdeavnkmknwissf
    gpqidgvvaqnddmglgalqalkeagrtgvpivgidgiedglnavksgdfigtslqngtv
    elsaglavadalvkgedvktdpvyvmpaitkdnvdvaiehvvterqkfldglveltqqnl
    ktgdiayegipgqt