PDB entry 5hkk

View 5hkk on RCSB PDB site
Description: Caldalaklibacillus thermarum F1-ATPase (wild type)
Class: hydrolase
Keywords: Hydrolase, F1-ATPase, Complex
Deposited on 2016-01-14, released 2016-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase subunit alpha
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpA, CathTA2_2809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkka1, d5hkka2, d5hkka3
  • Chain 'B':
    Compound: ATP synthase subunit alpha
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpA, CathTA2_2809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkkb1, d5hkkb2, d5hkkb3
  • Chain 'C':
    Compound: ATP synthase subunit alpha
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpA, CathTA2_2809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkkc1, d5hkkc2, d5hkkc3
  • Chain 'D':
    Compound: ATP synthase subunit beta
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpD, CathTA2_2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkkd1, d5hkkd2, d5hkkd3
  • Chain 'E':
    Compound: ATP synthase subunit beta
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpD, CathTA2_2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkke1, d5hkke2, d5hkke3
  • Chain 'F':
    Compound: ATP synthase subunit beta
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpD, CathTA2_2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkkf1, d5hkkf2, d5hkkf3
  • Chain 'G':
    Compound: ATP synthase gamma chain
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpG, CathTA2_2808
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkkg_
  • Chain 'H':
    Compound: ATP synthase epsilon chain
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpC, CathTA2_2806
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: ATP synthase subunit alpha
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpA, CathTA2_2809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkki1, d5hkki2, d5hkki3
  • Chain 'J':
    Compound: ATP synthase subunit alpha
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpA, CathTA2_2809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkkj1, d5hkkj2, d5hkkj3
  • Chain 'K':
    Compound: ATP synthase subunit alpha
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpA, CathTA2_2809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkkk1, d5hkkk2, d5hkkk3
  • Chain 'L':
    Compound: ATP synthase subunit beta
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpD, CathTA2_2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkkl1, d5hkkl2, d5hkkl3
  • Chain 'M':
    Compound: ATP synthase subunit beta
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpD, CathTA2_2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkkm1, d5hkkm2, d5hkkm3
  • Chain 'N':
    Compound: ATP synthase subunit beta
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpD, CathTA2_2807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkkn1, d5hkkn2, d5hkkn3
  • Chain 'O':
    Compound: ATP synthase gamma chain
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpG, CathTA2_2808
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hkko_
  • Chain 'P':
    Compound: ATP synthase epsilon chain
    Species: Caldalkalibacillus thermarum TA2.A1 [TaxId:986075]
    Gene: atpC, CathTA2_2806
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADP, MG, GOL, PO4, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hkkA (A:)
    msirpeeisalikkqienyeadlevvevgtviqvgdgiarvhglekvmagellefengvm
    gmaqnleednvgvvilgpyteiregtqvkrtgrimevpvgeallgrvvnplgqpldgrgp
    ietaeyrpiespapgvmdrksvheplqtgikaidsmipigrgqreliigdrqtgkttiai
    dtiinqkgqdviciyvaigqkqstvagvvetlrqhdaldytivvtasasepapllylapy
    agcamgeyfmykgkhalvvyddlskqaaayrelslllrrppgreaypgdvfylhsrller
    aaklsdekgggsltalpfietqagdvsayiptnvisitdgqiflesdlfysgvrpavnvg
    isvsrvggaaqikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveil
    kqdehkpmpveeqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtge
    lpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkA (A:)
    vevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteireg
    tqvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhep
    lqtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstv
    agvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlsk
    qaaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagd
    vsayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrld
    laqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfm
    ddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hkkB (B:)
    msirpeeisalikkqienyeadlevvevgtviqvgdgiarvhglekvmagellefengvm
    gmaqnleednvgvvilgpyteiregtqvkrtgrimevpvgeallgrvvnplgqpldgrgp
    ietaeyrpiespapgvmdrksvheplqtgikaidsmipigrgqreliigdrqtgkttiai
    dtiinqkgqdviciyvaigqkqstvagvvetlrqhdaldytivvtasasepapllylapy
    agcamgeyfmykgkhalvvyddlskqaaayrelslllrrppgreaypgdvfylhsrller
    aaklsdekgggsltalpfietqagdvsayiptnvisitdgqiflesdlfysgvrpavnvg
    isvsrvggaaqikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveil
    kqdehkpmpveeqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtge
    lpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkB (B:)
    evgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteiregt
    qvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhepl
    qtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstva
    gvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskq
    aaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdv
    sayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrldl
    aqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmd
    dipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hkkC (C:)
    msirpeeisalikkqienyeadlevvevgtviqvgdgiarvhglekvmagellefengvm
    gmaqnleednvgvvilgpyteiregtqvkrtgrimevpvgeallgrvvnplgqpldgrgp
    ietaeyrpiespapgvmdrksvheplqtgikaidsmipigrgqreliigdrqtgkttiai
    dtiinqkgqdviciyvaigqkqstvagvvetlrqhdaldytivvtasasepapllylapy
    agcamgeyfmykgkhalvvyddlskqaaayrelslllrrppgreaypgdvfylhsrller
    aaklsdekgggsltalpfietqagdvsayiptnvisitdgqiflesdlfysgvrpavnvg
    isvsrvggaaqikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveil
    kqdehkpmpveeqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtge
    lpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkC (C:)
    evgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteiregt
    qvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhepl
    qtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstva
    gvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskq
    aaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdv
    sayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrldl
    aqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmd
    dipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftpsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hkkD (D:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkD (D:)
    nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
    dglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeel
    stadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfagv
    gertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvl
    lfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyv
    paddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrvar
    gvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgkyv
    pvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hkkE (E:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkE (E:)
    nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
    dglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeel
    stadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfagv
    gertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvl
    lfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyv
    paddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrvar
    gvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgkyv
    pvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hkkF (F:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkF (F:)
    nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
    dglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeel
    stadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfagv
    gertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvl
    lfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyv
    paddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrvar
    gvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgkyv
    pvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5hkkG (G:)
    mqgmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagt
    kdfshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgr
    kgrdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspiv
    qrpvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefga
    rmtamgnatdnatemletltlqfnrarqaaitqeiaeivaganalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkG (G:)
    gmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagtkd
    fshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgrkg
    rdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspivqr
    pvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefgarm
    tamgnatdnatemletltlqfnrarqaaitqeiaeivaganalr
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5hkkI (I:)
    msirpeeisalikkqienyeadlevvevgtviqvgdgiarvhglekvmagellefengvm
    gmaqnleednvgvvilgpyteiregtqvkrtgrimevpvgeallgrvvnplgqpldgrgp
    ietaeyrpiespapgvmdrksvheplqtgikaidsmipigrgqreliigdrqtgkttiai
    dtiinqkgqdviciyvaigqkqstvagvvetlrqhdaldytivvtasasepapllylapy
    agcamgeyfmykgkhalvvyddlskqaaayrelslllrrppgreaypgdvfylhsrller
    aaklsdekgggsltalpfietqagdvsayiptnvisitdgqiflesdlfysgvrpavnvg
    isvsrvggaaqikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveil
    kqdehkpmpveeqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtge
    lpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkI (I:)
    evgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteiregt
    qvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhepl
    qtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstva
    gvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskq
    aaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdv
    sayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrldl
    aqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmd
    dipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5hkkJ (J:)
    msirpeeisalikkqienyeadlevvevgtviqvgdgiarvhglekvmagellefengvm
    gmaqnleednvgvvilgpyteiregtqvkrtgrimevpvgeallgrvvnplgqpldgrgp
    ietaeyrpiespapgvmdrksvheplqtgikaidsmipigrgqreliigdrqtgkttiai
    dtiinqkgqdviciyvaigqkqstvagvvetlrqhdaldytivvtasasepapllylapy
    agcamgeyfmykgkhalvvyddlskqaaayrelslllrrppgreaypgdvfylhsrller
    aaklsdekgggsltalpfietqagdvsayiptnvisitdgqiflesdlfysgvrpavnvg
    isvsrvggaaqikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveil
    kqdehkpmpveeqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtge
    lpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkJ (J:)
    evgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteiregt
    qvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhepl
    qtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstva
    gvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskq
    aaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdv
    sayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrldl
    aqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtngfmd
    dipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftps
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5hkkK (K:)
    msirpeeisalikkqienyeadlevvevgtviqvgdgiarvhglekvmagellefengvm
    gmaqnleednvgvvilgpyteiregtqvkrtgrimevpvgeallgrvvnplgqpldgrgp
    ietaeyrpiespapgvmdrksvheplqtgikaidsmipigrgqreliigdrqtgkttiai
    dtiinqkgqdviciyvaigqkqstvagvvetlrqhdaldytivvtasasepapllylapy
    agcamgeyfmykgkhalvvyddlskqaaayrelslllrrppgreaypgdvfylhsrller
    aaklsdekgggsltalpfietqagdvsayiptnvisitdgqiflesdlfysgvrpavnvg
    isvsrvggaaqikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveil
    kqdehkpmpveeqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtge
    lpdtkeldaaieefkkgftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkK (K:)
    vvevgtviqvgdgiarvhglekvmagellefengvmgmaqnleednvgvvilgpyteire
    gtqvkrtgrimevpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvhe
    plqtgikaidsmipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqst
    vagvvetlrqhdaldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddls
    kqaaayrelslllrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqag
    dvsayiptnvisitdgqiflesdlfysgvrpavnvgisvsrvggaaqikamkkvagtlrl
    dlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpveeqvisiyavtngf
    mddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgftpsa
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5hkkL (L:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkL (L:)
    nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
    dglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeel
    stadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfagv
    gertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvl
    lfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyv
    paddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrvar
    gvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgkyv
    pvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5hkkM (M:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkM (M:)
    nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
    dglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeel
    stadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfagv
    gertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvl
    lfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyv
    paddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrvar
    gvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgkyv
    pvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5hkkN (N:)
    mnkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamas
    tdglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefee
    lstadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfag
    vgertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdv
    llfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiy
    vpaddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrva
    rgvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgky
    vpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkN (N:)
    nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
    dglvrgleavdtgapisvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeel
    stadeiletgikvidllapyakggkiglfggagvgktvliqelinnvaqehgglsvfagv
    gertregndlyhemkdsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvl
    lfidnifrftqagsevsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyv
    paddytdpapattfahldattnlerklaemgiypavdplastsrilspavvgeehyrvar
    gvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhvaeqftgmpgkyv
    pvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5hkkO (O:)
    mqgmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagt
    kdfshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgr
    kgrdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspiv
    qrpvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefga
    rmtamgnatdnatemletltlqfnrarqaaitqeiaeivaganalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkkO (O:)
    gmreikrrirsvkntrqitkamkmvaaaklrraqetaenarpyadkikevissiaagtkd
    fshpmlearpvkktgymvitsdrglagpynanilrlvsktieerhqskdeyvifavgrkg
    rdffkkrgypvveevtgisdtpslteiqdiaqsaigmfadetfdkltifynefvspivqr
    pvekqllpltseevldgpvsayeyepdsesvlevllpkyaetliysalldakasefgarm
    tamgnatdnatemletltlqfnrarqaaitqeiaeivaganalr
    

  • Chain 'P':
    No sequence available.