PDB entry 5hkg

View 5hkg on RCSB PDB site
Description: Total chemical synthesis, refolding and crystallographic structure of a fully active immunophilin: calstabin 2 (FKBP12.6).
Class: isomerase
Keywords: Synthetic protein, Refolding, immunophilin, isomerase
Deposited on 2016-01-14, released 2016-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase fkbp1b
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP1B, FKBP12.6, FKBP1L, FKBP9, OTK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5hkga_
  • Heterogens: RAP, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5hkgA (A:)
gveietispgdgrtfpkkgqtcvvhytgmlqngkkfdssrdrnkpfkfrigkqevikgfe
egaaqmslgqrakltctpdvaygatghpgvippnatlifdvellnle